B7-H2/ICOSLG Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit B7-H2/ICOSLG Antibody - BSA Free (NBP2-68606) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ICOSLG |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Recommended conditions: ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for B7-H2/ICOSLG Antibody - BSA Free
Background
B7-RP1 is a 40 kD protein, also known as ICOS ligand, B7-H2, and B7h. It has recently been clustered as CD275. It is a member of the immunoglobulin receptor superfamily expressed on splenic B cells, dendritic cells and macrophages. The expression of this antigen is increased by TNF- alpha stimulation and is highly upregulated by local inflammation. B7RP1 binds to ICOS and co-stimulates T cell and B cell responses. Two isoforms of this protein have been reported to occur as a result of alternative splicing. These isoforms show differential tissue distribution.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: AgAct, ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Block, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ICC/IF
Publications for B7-H2/ICOSLG Antibody (NBP2-68606) (0)
There are no publications for B7-H2/ICOSLG Antibody (NBP2-68606).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for B7-H2/ICOSLG Antibody (NBP2-68606) (0)
There are no reviews for B7-H2/ICOSLG Antibody (NBP2-68606).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for B7-H2/ICOSLG Antibody (NBP2-68606) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional B7-H2/ICOSLG Products
Research Areas for B7-H2/ICOSLG Antibody (NBP2-68606)
Find related products by research area.
|
Blogs on B7-H2/ICOSLG