ATP7A Antibody

Images

 
Immunohistochemistry-Paraffin: ATP7A Antibody [NBP1-82631] - Staining of human hippocampus shows strong cytoplasmic positivity in neuronal cells and glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATP7A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATP7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH6 retrieval is recommended.
Control Peptide
ATP7A Protein (NBP1-82631PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATP7A Antibody

  • ATPase, Cu++ transporting, alpha polypeptide
  • Copper pump 1
  • copper-transporting ATPase 1
  • Cu++-transporting P-type ATPase
  • DSMAX
  • EC 3.6.3
  • EC 3.6.3.4
  • MC1
  • Menkes disease-associated protein
  • Menkes syndrome
  • MK
  • MNKFLJ17790
  • OHS
  • SMAX3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-258-PB
Species: Hu
Applications: WB, Simple Western, IHC
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06611
Species: Hu
Applications: WB, ICC/IF
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
H00008569-M14
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for ATP7A Antibody (NBP1-82631) (0)

There are no publications for ATP7A Antibody (NBP1-82631).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP7A Antibody (NBP1-82631) (0)

There are no reviews for ATP7A Antibody (NBP1-82631). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ATP7A Antibody (NBP1-82631) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATP7A Products

Bioinformatics Tool for ATP7A Antibody (NBP1-82631)

Discover related pathways, diseases and genes to ATP7A Antibody (NBP1-82631). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP7A Antibody (NBP1-82631)

Discover more about diseases related to ATP7A Antibody (NBP1-82631).
 

Pathways for ATP7A Antibody (NBP1-82631)

View related products by pathway.

PTMs for ATP7A Antibody (NBP1-82631)

Learn more about PTMs related to ATP7A Antibody (NBP1-82631).

Blogs on ATP7A

There are no specific blogs for ATP7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATP7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATP7A
Entrez
Uniprot