ATG4A Antibody

Images

 
Western Blot: ATG4A Antibody [NBP1-89044] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-50
Immunohistochemistry-Paraffin: ATG4A Antibody [NBP1-89044] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATG4A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSPQRMNILNLDPSVALGFFCKEEKDFDNWCSLVQKEILKENLRMFELVQKHPSHWPPFVPPAKPEVTTTGAEFIDSTEQLEEFDLEEDFEILSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATG4A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATG4A Protein (NBP1-89044PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATG4A Antibody

  • APG4 autophagy 4 homolog A (S. cerevisiae)
  • Apg4a
  • ATG4 autophagy related 4 homolog A (S. cerevisiae)
  • ATG4A
  • Atg4al
  • Autl2
  • AUT-like 2 cysteine endopeptidase
  • AUT-like 2, cysteine endopeptidase (S. cerevisiae)
  • Autophagin 2
  • autophagin-2
  • cysteine endopeptidase
  • cysteine protease ATG4A
  • EC 3.4.22
  • EC 3.4.22.-
  • hAPG4A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NB500-249
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-71771
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33090
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-89043
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
AF8216
Species: Hu, Mu, Rt
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-33488
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB110-60928
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, EM, IHC, IHC-P
NB100-2220
Species: Hu, Mu, Rt, Po, Ba, Bv, Ca, SyHa, Pm, Ze
Applications: WB, Simple Western, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KO
NBP2-01083
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for ATG4A Antibody (NBP1-89044) (0)

There are no publications for ATG4A Antibody (NBP1-89044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATG4A Antibody (NBP1-89044) (0)

There are no reviews for ATG4A Antibody (NBP1-89044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATG4A Antibody (NBP1-89044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATG4A Products

ATG4A NBP1-89044

Bioinformatics Tool for ATG4A Antibody (NBP1-89044)

Discover related pathways, diseases and genes to ATG4A Antibody (NBP1-89044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATG4A Antibody (NBP1-89044)

Discover more about diseases related to ATG4A Antibody (NBP1-89044).
 

Pathways for ATG4A Antibody (NBP1-89044)

View related products by pathway.

PTMs for ATG4A Antibody (NBP1-89044)

Learn more about PTMs related to ATG4A Antibody (NBP1-89044).
 

Research Areas for ATG4A Antibody (NBP1-89044)

Find related products by research area.

Blogs on ATG4A.

ATG4A - protease that initiates ATG8 lipidation during autophagosome elongation
There are 3 major autophagy pathways- microautophagy, chaperone-mediated autophagy, and macroautophagy. Macroautophagy is the pathway herein referred to as simply autophagy. Autophagy can be broken down into 4 main stages: phagophore nucleatio...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATG4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATG4A
Entrez