![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining in human skin and liver tissues using NBP2-33981 antibody. Corresponding ASPRV1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0020.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining in human skin and liver tissues using NBP2-33981 antibody. Corresponding ASPRV1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, CaSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASPRV1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in ICC/IF reported in scientific literature (PMID 28249031). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Western_Blot_5321.jpg)
![Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Simple_Western_16637.jpg)
![Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]](https://images.novusbio.com/images2/Myeloperoxidase_AF3667_Immunocytochemistry__Immunofluorescence_17390.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using NBP2-33981 | Applications | Species |
|---|---|---|
| Bauer A, Waluk DP, Galichet A et al. A de novo variant in the ASPRV1 gene in a dog with ichthyosis. PLoS Genet. 2017-03-01 [PMID: 28249031] (ICC/IF, Canine) | ICC/IF | Canine |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human cervix, uterine, liver, lymphoid tissues and skin using Anti-ASPRV1 antibody NBP2-33981 (A) shows similar protein distribution across tissues to independent antibody NBP1-83570 (B).](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0015.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human cervix, uterine, liver, lymphoid tissues and skin using Anti-ASPRV1 antibody NBP2-33981 (A) shows similar protein distribution across tissues to independent antibody NBP1-83570 (B).")
![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0016.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0017.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.")
![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0018.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human uterine cervix shows moderate to strong cytoplasmic positivity in keratinocytes.](http://images.novusbio.com/fullsize/ASPRV1-Antibody-Immunohistochemistry-Paraffin-NBP2-33981-img0019.jpg "Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human uterine cervix shows moderate to strong cytoplasmic positivity in keratinocytes.")
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")