ASPRV1 Antibody


Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human colon.
Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human skin shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining in human skin and skeletal muscle tissues using anti-ASPRV1 antibody. Corresponding ASPRV1 RNA-seq data are presented more
Independent Antibodies: Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human cerebral cortex, colon, liver and skin using Anti-ASPRV1 antibody NBP2-33981 (A) shows similar protein more
Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: ASPRV1 Antibody [NBP2-33981] - Staining of human liver.

Product Details

Reactivity Hu, CaSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

ASPRV1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: GKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLELIEEDPSSEEGRQELSH
Specificity of human, canine ASPRV1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28249031).
Control Peptide
Read Publication using
NBP2-33981 in the following applications:

Reactivity Notes

Canine reactivity reported in scientific literature (PMID: 28249031). Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ASPRV1 Antibody

  • aspartic peptidase, retroviral-like 1
  • EC 3.4.23.-
  • FLJ25084
  • retroviral-like aspartic protease 1
  • Skin aspartic protease
  • Skin-specific retroviral-like aspartic protease
  • Taps
  • TPA-inducible aspartic proteinase-like protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Rb
Applications: WB, Flow, IHC-P, KO
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ca
Applications: ICC/IF, IHC, IHC-P

Publications for ASPRV1 Antibody (NBP2-33981)(1)

We have publications tested in 1 confirmed species: Canine.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ASPRV1 Antibody (NBP2-33981) (0)

There are no reviews for ASPRV1 Antibody (NBP2-33981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ASPRV1 Antibody (NBP2-33981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASPRV1 Products

Bioinformatics Tool for ASPRV1 Antibody (NBP2-33981)

Discover related pathways, diseases and genes to ASPRV1 Antibody (NBP2-33981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASPRV1 Antibody (NBP2-33981)

Discover more about diseases related to ASPRV1 Antibody (NBP2-33981).

Pathways for ASPRV1 Antibody (NBP2-33981)

View related products by pathway.

Blogs on ASPRV1

There are no specific blogs for ASPRV1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASPRV1 Antibody and receive a gift card or discount.


Gene Symbol ASPRV1