NARG1L Antibody

Images

 
Western Blot: NARG1L Antibody [NBP1-92167] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: NARG1L Antibody [NBP1-92167] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: NARG1L Antibody [NBP1-92167] - Staining of human appendix shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NARG1L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LVEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTLVPGERF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NAA16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NARG1L Protein (NBP1-92167PEP)

Reactivity Notes

Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NARG1L Antibody

  • FLJ22054
  • MGC40612
  • N(alpha)-acetyltransferase 16, NatA auxiliary subunit
  • N-alpha-acetyltransferase 16, NatA auxiliary subunit
  • NARG1L
  • NARG1-like protein
  • NAT2
  • NMDA receptor regulated 1-like
  • NMDA receptor-regulated 1-like protein
  • PRO2435

Background

NARG1L may belong to a complex displaying N-terminal acetyltransferase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NARG1L Antibody (NBP1-92167) (0)

There are no publications for NARG1L Antibody (NBP1-92167).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NARG1L Antibody (NBP1-92167) (0)

There are no reviews for NARG1L Antibody (NBP1-92167). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NARG1L Antibody (NBP1-92167) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NARG1L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NAA16