ACAD8 Antibody

Images

 
Western Blot: ACAD8 Antibody [NBP2-47559] - Analysis in control (vector only transfected HEK293T lysate) and ACAD8 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining in human kidney and lymph node tissues using NBP2-47559 antibody. Corresponding ACAD8 RNA-seq data are presented for ...read more
Western Blot: ACAD8 Antibody [NBP2-47559] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HEL
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human lymph node shows weak granular cytoplasmic positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ACAD8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACAD8 Protein (NBP2-47559PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAD8 Antibody

  • ACAD-8
  • Activator-recruited cofactor 42 kDa component
  • Acyl-CoA dehydrogenase family member 8
  • acyl-CoA dehydrogenase family, member 8
  • acyl-Coenzyme A dehydrogenase family, member 8
  • ARC42
  • EC 1.3.99
  • EC 1.3.99.-
  • FLJ22590
  • IBD
  • isobutyryl-CoA dehydrogenase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY417
Species: Mu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
PP-H7431-00
Species: Hu
Applications: WB
NB110-59086
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DY3667
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DY421
Species: Mu
Applications: ELISA
MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
202-IL
Species: Hu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB

Publications for ACAD8 Antibody (NBP2-47559) (0)

There are no publications for ACAD8 Antibody (NBP2-47559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD8 Antibody (NBP2-47559) (0)

There are no reviews for ACAD8 Antibody (NBP2-47559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAD8 Antibody (NBP2-47559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACAD8 Products

Bioinformatics Tool for ACAD8 Antibody (NBP2-47559)

Discover related pathways, diseases and genes to ACAD8 Antibody (NBP2-47559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD8 Antibody (NBP2-47559)

Discover more about diseases related to ACAD8 Antibody (NBP2-47559).
 

Pathways for ACAD8 Antibody (NBP2-47559)

View related products by pathway.

PTMs for ACAD8 Antibody (NBP2-47559)

Learn more about PTMs related to ACAD8 Antibody (NBP2-47559).
 

Research Areas for ACAD8 Antibody (NBP2-47559)

Find related products by research area.

Blogs on ACAD8

There are no specific blogs for ACAD8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD8