ACAD8 Antibody

Images

 
Western Blot: ACAD8 Antibody [NBP2-47559] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line HEL
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: ACAD8 Antibody [NBP2-47559] - Staining in human kidney and pancreas tissues using anti-ACAD8 antibody. Corresponding ACAD8 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACAD8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLNVRKQFGEPLASNQYLQFTLADMA
Specificity
Specificity of human ACAD8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACAD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACAD8 Protein (NBP2-47559PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACAD8 Antibody

  • ACAD-8
  • Activator-recruited cofactor 42 kDa component
  • Acyl-CoA dehydrogenase family member 8
  • acyl-CoA dehydrogenase family, member 8
  • acyl-Coenzyme A dehydrogenase family, member 8
  • ARC42
  • EC 1.3.99
  • EC 1.3.99.-
  • FLJ22590
  • IBD
  • isobutyryl-CoA dehydrogenase, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5739
Species: Hu, Mu, Rt
Applications: WB
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC

Publications for ACAD8 Antibody (NBP2-47559) (0)

There are no publications for ACAD8 Antibody (NBP2-47559).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACAD8 Antibody (NBP2-47559) (0)

There are no reviews for ACAD8 Antibody (NBP2-47559). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACAD8 Antibody (NBP2-47559) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ACAD8 Antibody (NBP2-47559)

Discover related pathways, diseases and genes to ACAD8 Antibody (NBP2-47559). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACAD8 Antibody (NBP2-47559)

Discover more about diseases related to ACAD8 Antibody (NBP2-47559).
 

Pathways for ACAD8 Antibody (NBP2-47559)

View related products by pathway.

PTMs for ACAD8 Antibody (NBP2-47559)

Learn more about PTMs related to ACAD8 Antibody (NBP2-47559).
 

Research Areas for ACAD8 Antibody (NBP2-47559)

Find related products by research area.

Blogs on ACAD8

There are no specific blogs for ACAD8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACAD8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACAD8