ASGPR1 Antibody


Western Blot: ASGPR1 Antibody [NBP1-85581] - Analysis in human cell line HepG2.
Immunocytochemistry/ Immunofluorescence: ASGPR1 Antibody [NBP1-85581] - Immunofluorescent staining of human cell line Hep G2 shows localization to vesicles. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ASGPR1 Antibody [NBP1-85581] - Staining in human liver and pancreas tissues using anti-ASGR1 antibody. Corresponding ASGR1 RNA-seq data are presented for the more
Immunohistochemistry-Paraffin: ASGPR1 Antibody [NBP1-85581] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: ASGPR1 Antibody [NBP1-85581] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ASGPR1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL
Specificity of human ASGPR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ASGPR1 Protein (NBP1-85581PEP)
Read Publication using
NBP1-85581 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23979840).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ASGPR1 Antibody

  • ASGPR 1
  • ASGP-R 1
  • ASGPR1
  • ASGR1
  • asialoglycoprotein receptor 1
  • CLEC4H1
  • C-type lectin domain family 4 member H1
  • Hepatic lectin H1
  • HL-1
  • MHL1
  • RHL1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
Species: Mu
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA

Publications for ASGPR1 Antibody (NBP1-85581)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for ASGPR1 Antibody (NBP1-85581) (0)

There are no reviews for ASGPR1 Antibody (NBP1-85581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ASGPR1 Antibody (NBP1-85581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ASGPR1 Products

Bioinformatics Tool for ASGPR1 Antibody (NBP1-85581)

Discover related pathways, diseases and genes to ASGPR1 Antibody (NBP1-85581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ASGPR1 Antibody (NBP1-85581)

Discover more about diseases related to ASGPR1 Antibody (NBP1-85581).

Pathways for ASGPR1 Antibody (NBP1-85581)

View related products by pathway.

Blogs on ASGPR1

There are no specific blogs for ASGPR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ASGPR1 Antibody and receive a gift card or discount.


Gene Symbol ASGR1