DNAH6 Antibody

Images

 
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human placenta shows low expression as expected.
Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining of human fallopian tube shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DNAH6 Antibody [NBP1-84067] - Staining in human fallopian tube and placenta tissues using anti-DNAH6 antibody. Corresponding DNAH6 RNA-seq data are presented ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

DNAH6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TKLNTILCQTFVFCYLWSLGGNLTENYYDSFDTFIRTQFDDNPDARLPNSGDLWSIHMDFDTKRLDPWERIIPTFKYNRDVP
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DNAH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
DNAH6 Protein (NBP1-84067PEP)

Reactivity Notes

Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DNAH6 Antibody

  • axonemal
  • Ciliary dynein heavy chain 6
  • Dnahc6
  • DNHL1
  • dynein heavy chain-like 1
  • dynein, axonemal, heavy chain 6
  • dynein, axonemal, heavy polypeptide 6
  • FLJ23529
  • FLJ37357
  • HL-2
  • HL2DKFZp667K087
  • KIAA1697
  • MGC132544
  • MGC141984
  • MGC177197

Background

Dyneins are microtubule-associated motor protein complexes composed of several heavy, light, and intermediate chains.Two major classes of dyneins, axonemal and cytoplasmic, have been identified. DNAH6 is an axonemal dynein heavy chain(DHC) (Vaughan et al., 1996 (PubMed 8812413)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4254
Species: Hu
Applications: ICC, IHC, WB
NBP1-84463
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88582
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-60150
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP3-04922
Species: Hu
Applications: ICC/IF, WB
NBP1-32767
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-93677
Species: Hu, Mu, Rt
Applications: WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NB110-74682
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03891
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-84067
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for DNAH6 Antibody (NBP1-84067) (0)

There are no publications for DNAH6 Antibody (NBP1-84067).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAH6 Antibody (NBP1-84067) (0)

There are no reviews for DNAH6 Antibody (NBP1-84067). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for DNAH6 Antibody (NBP1-84067) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DNAH6 Products

Bioinformatics Tool for DNAH6 Antibody (NBP1-84067)

Discover related pathways, diseases and genes to DNAH6 Antibody (NBP1-84067). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DNAH6

There are no specific blogs for DNAH6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DNAH6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DNAH6