Asialoglycoprotein Receptor 2 Antibody

Images

 
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Analysis in human cell line CACO-2.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Simple Western: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Simple Western lane view shows a specific band for ASGR2 in 0.2 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Asialoglycoprotein Receptor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASGR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Asialoglycoprotein Receptor 2 Antibody

  • ASGPR 2
  • ASGP-R 2
  • ASGPR2
  • ASGP-R2
  • ASGR2
  • asialoglycoprotein receptor 2
  • CLEC4H2
  • CLEC4H2FLJ60040
  • C-type lectin domain family 4 member H2
  • HBxAg-binding protein
  • HBXBP
  • Hepatic lectin H2
  • HL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60150
Species: Hu, Mu, Rt
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr
AF4254
Species: Hu
Applications: WB, IHC, ICC
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-32767
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-12547
Species: Hu
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB100-56495
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC-P
NBP1-88057
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31553
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-12553
Species: Hu
NBP1-89090
Species: Hu
Applications: IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (0)

There are no publications for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (0)

There are no reviews for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Asialoglycoprotein Receptor 2 Products

Bioinformatics Tool for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578)

Discover related pathways, diseases and genes to Asialoglycoprotein Receptor 2 Antibody (NBP1-85578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578)

View related products by pathway.

Blogs on Asialoglycoprotein Receptor 2

There are no specific blogs for Asialoglycoprotein Receptor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Asialoglycoprotein Receptor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASGR2
Entrez