Home » Asialoglycoprotein Receptor 2 » Asialoglycoprotein Receptor 2 Research Products » Asialoglycoprotein Receptor 2 Antibody

Asialoglycoprotein Receptor 2 Antibody

 (1 Review)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Analysis in human cell line HepG2.
Western Blot: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human pancreas using Anti-ASGR2 antibody NBP1-85578.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human liver shows high expression.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human pancreas shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining in human liver and pancreas tissues using anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human colon, liver, lymph node and pancreas using Anti-ASGR2 antibody NBP1-85578 (A) shows ...read more
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human colon.
Immunohistochemistry-Paraffin: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Staining of human liver using Anti-ASGR2 antibody NBP1-85578.
Simple Western: Asialoglycoprotein Receptor 2 Antibody [NBP1-85578] - Simple Western lane view shows a specific band for ASGR2 in 0.2 mg/ml of HepG2 lysate. This experiment was performed under reducing conditions ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

Asialoglycoprotein Receptor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC
Specificity
Specificity of human Asialoglycoprotein Receptor 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASGR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Simple Western 1:20
  • Immunohistochemistry 1:5000 - 1:10000
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Asialoglycoprotein Receptor 2 Recombinant Protein Antigen (NBP1-85578PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-85578 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Asialoglycoprotein Receptor 2 Antibody

  • ASGPR 2
  • ASGP-R 2
  • ASGPR2
  • ASGP-R2
  • ASGR2
  • asialoglycoprotein receptor 2
  • CLEC4H2
  • CLEC4H2FLJ60040
  • C-type lectin domain family 4 member H2
  • HBxAg-binding protein
  • HBXBP
  • Hepatic lectin H2
  • HL-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ASGPR1 Antibody
NBP1-54385
Western Blot: ASGPR1 Antibody [NBP1-54385] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml
Western Blot: ASGPR1 Antibody [NBP1-54385] - Liver, concentration 0.6ug/ml.
Western Blot: ASGPR1 Antibody [NBP1-54385] - Tissue: HepG2.
Species: Hu
Applications: WB, IHC

Intelectin-1/Omentin A ...
AF4254
Intelectin‑1/Omentin was detected in immersion fixed U937 human histiocytic lymphoma cell line using Sheep Anti-Human Intelectin‑1/Omentin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4254) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Intelectin‑1/Omentin was detected in immersion fixed frozen sections of mouse intestine using 10 µg/mL Sheep Anti-Human Intelectin‑1/Omentin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4254) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(3 Publications)
Species: Hu
Applications: WB, IHC, ICC
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (OTI4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY HES1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-HES1 (1:500).
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (OTI4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (OTI4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(6 Publications)
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
HMGCL Antibody
NBP1-32767
Western Blot: HMGCL Antibody [NBP1-32767] - rat liver lysate/extract 10 % SDS-PAGE gel, antibody dilution 1:10000.
Immunocytochemistry/Immunofluorescence: HMGCL Antibody [NBP1-32767] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: HMGCL protein stained by HMGCL antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
Immunohistochemistry-Paraffin: HMGCL Antibody [NBP1-32767] - Paraffin-embedded SW480 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
LIPC Antibody
NBP3-04922
Immunocytochemistry/Immunofluorescence: LIPC Antibody [NBP3-04922] - Analysis of A549 cells using LIPC antibody. Blue: DAPI for nuclear staining.
Species: Hu
Applications: WB, ICC/IF
Aquaporin-2
Antibody
NB110-74682
Western Blot: Aquaporin-2 Antibody [NB110-74682] - Detection of Aquaporin 2 in rat kidney extracts. Cortex (CX), Outer Medulla (OM), Inner Medulla Base (IMB), Inner Medulla Papilla (IMP).
Immunocytochemistry/Immunofluorescence: Aquaporin-2 Antibody [NB110-74682] - Staining of mpkCCD cell line
Immunohistochemistry-Paraffin: Aquaporin-2 Antibody [NB110-74682] - Analysis of FFPE human kidney using 1:100 conc. of Aquaporin-2 antibody on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Lumenal staining of Aquaporin-2 in scattered tubules was observed. Staining was performed by Histowiz.
(24 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MYL7 Antibody
(OTI4E7)
NBP2-03891
Western Blot: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYL7 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYL7.
Immunohistochemistry-Paraffin: MYL7 Antibody (4E7) [NBP2-03891] Staining of paraffin-embedded Human liver tissue using anti-MYL7 mouse monoclonal antibody.
Flow Cytometry: MYL7 Antibody (4E7) [NBP2-03891] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-MYL7 antibody, and then analyzed by flow cytometry.
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Lipoprotein a
Antibody (4H1)
NBP2-37477
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Lipoprotein a Antibody (4H1) [NBP2-37477] - Analysis of rectum cancer tissues using LPA mouse mAb with DAB staining.
(2 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Exportin 4 Antibody
NB100-56495
Western Blot: Exportin 4 Antibody [NB100-56495] - Analysis of Exportin-4 in Jurkat cell lysate in the 1) absence and 2) presence of immunizing peptide using this antibody.
Immunohistochemistry-Paraffin: Exportin 4 Antibody [NB100-56495] - Formalin-fixed, paraffin-embedded human hepatocellular carcinoma stained with TEM8 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
Immunohistochemistry-Paraffin: Exportin 4 Antibody [NB100-56495] - Formalin-fixed, paraffin-embedded human liver stained with TEM8 antibody (5 ug/ml), peroxidase-conjugate and DAB chromogen. Staining of formalin-fixed tissues is enhanced by boiling tissue sections in 10 mM sodium citrate buffer, pH 6.0 for 10-20 min followed by cooling at RT for 20 min.
(1 Publication)
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, IHC, IHC-P
Plastin L Antibody
NBP2-19860
Western Blot: Plastin L Antibody [NBP2-19860] - Various whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with L-Plastin antibody diluted at 1:10000. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Plastin L Antibody [NBP2-19860] - Plastin L antibody detects Plastin L protein by immunofluorescent analysis. Sample: A549 cells were fixed in ice-cold MeOH for 5 min. Green: Plastin Lstained by Plastin L antibody diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar= 10 um.
Immunohistochemistry-Paraffin: Plastin L Antibody [NBP2-19860] - Paraffin-embedded mouse thymus gland. Plastin L antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
GLI-2 Antibody
AF3635
GLI‑2 was detected in immersion fixed frozen sections of mouse embryo (15 d.p.c.) using Goat Anti-Mouse GLI‑2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3635) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling when primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. Specific staining was localized to developing muscle. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(14 Publications)
Species: Mu
Applications: WB, IHC
Radixin Antibody
(SC06-14)
NBP2-67584
Western Blot: Radixin Antibody (SC06-22) [NBP2-67584] - Analysis of Radixin on different lysates using anti-Radixin antibody at 1/1,000 dilution. Positive control: Lane 1: Hela Lane 2: A431 Lane 3: HepG2
Immunocytochemistry/Immunofluorescence: Radixin Antibody (SC06-22) [NBP2-67584] - Staining Radixin in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Radixin Antibody (SC06-22) [NBP2-67584] - Analysis of paraffin-embedded mouse placenta tissue using anti-Radixin antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Human
Ceruloplasmin ELISA K ...
NBP2-60616
ELISA: Human Ceruloplasmin ELISA Kit (Colorimetric) [NBP2-60616]
Species: Hu
HESX1 Antibody
NBP1-89090
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts as well as in Leydig cells.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.
Immunohistochemistry-Paraffin: HESX1 Antibody [NBP1-89090] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.
Species: Hu
Applications: IHC, IHC-P
Atrial Natriuretic
Peptide/ANP Antibody
NBP2-14873
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Knockdown of ATE1 attenuates cardiac hypertrophy. Western blot analysis of ANP protein levels in heart samples from sham and renal ligated rats (B2) bar graph was generated by quantifying the blots and normalizing the intensities of bands to the untreated lane (C) BNP and (D) beta-MHC in Ligated ATE1 siRNA when compared with Ligated NS siRNA samples. Statistical analysis was carried out by one-way ANOVA. Data are represented as mean +/- SE. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-57379-7) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Mouse heart. ANP stained by ANP antibody [N1C3] diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Western Blot: Atrial Natriuretic Peptide/ANP Antibody [NBP2-14873] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with ANP antibody [N1C3] diluted at 1:2000.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PD-ECGF/Thymidine
Phosphorylase Antibod ...
NB100-2737
Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node. In benign lymph node, TP expression highlights the meshwork of macrophages (arrow in inset; 400x) and endothelial cells (arrowhead in inset; 400x). Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.
Immunohistochemistry: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Immunohistochemical staining of thymidine phosphorylase (TP) expression and related markers in benign lymph node in lymph node with malignant mycosis fungoides/Sezary syndrome cells (LN-MF). CD21 is negative in this case of LN-MF. Images are from an Olympus BX41 microscope (Olympus Corp., Tokyo, Japan) processed with Qcapture Pro 5.1 (QImaging, Surrey, BC, Canada). Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/ah/2011/875135/) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) [NB100-2737] - Analysis of Thymidine Phosphorylase formalin-fixed paraffin embedded human breast carcinoma.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
ABCB11 Antibody
NBP1-89319
Immunohistochemistry-Paraffin: ABCB11 Antibody [NBP1-89319] - Staining of human prostate shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: ABCB11 Antibody [NBP1-89319] - Staining of human liver shows moderate to strong membranous positivity in bile canaliculi.
Immunohistochemistry-Paraffin: ABCB11 Antibody [NBP1-89319] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.
(5 Publications)
Species: Hu
Applications: IHC, IHC-P

Publications for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (0)

There are no publications for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-85578:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Asialoglycoprotein Receptor 2 NBP1-85578
Enlarge 		5
reviewed by:
Anonymous
 WB Human 10/02/2020
View

Summary

ApplicationWestern Blot
Sample Tested3 human cancer cell lines
SpeciesHuman
LotA96321

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Asialoglycoprotein Receptor 2 Products

Bioinformatics Tool for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578)

Discover related pathways, diseases and genes to Asialoglycoprotein Receptor 2 Antibody (NBP1-85578). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for Asialoglycoprotein Receptor 2 Antibody (NBP1-85578)

View related products by pathway.

Blogs on Asialoglycoprotein Receptor 2

There are no specific blogs for Asialoglycoprotein Receptor 2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0
Western Blot Asialoglycoprotein Receptor 2 NBP1-85578
Enlarge
 Anonymous
10/02/2020
Application: WB
Species: Human
read this review

Bioinformatics

Gene Symbol ASGR2