ARMC8 Antibody

Images

 
Western Blot: ARMC8 Antibody [NBP1-69203] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARMC8 Antibody Summary

Immunogen
Synthetic peptides corresponding to ARMC8 (armadillo repeat containing 8) The peptide sequence was selected from the N terminal of ARMC8. Peptide sequence MEVTASSRHYVDRLFDPDPQKVLQGVIDMKNAVIGNNKQKANLIVLGAVP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARMC8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ARMC8 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ARMC8 Antibody

  • armadillo repeat containing 8
  • armadillo repeat-containing protein 8
  • DKFZP434A043
  • HSPC056
  • MGC10058
  • MGC4880

Background

The function of ARMC8 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92337
Species: Hu, Mu, Am
Applications: WB, IHC, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91717
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-13234
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-83628
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32596
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
AF7288
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80655
Species: Hu
Applications: IHC, IHC-P
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15087
Species: Hu, Mu
Applications: WB
NBP1-59068
Species: Hu
Applications: WB
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31776
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-69203
Species: Hu
Applications: WB

Publications for ARMC8 Antibody (NBP1-69203) (0)

There are no publications for ARMC8 Antibody (NBP1-69203).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARMC8 Antibody (NBP1-69203) (0)

There are no reviews for ARMC8 Antibody (NBP1-69203). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARMC8 Antibody (NBP1-69203) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARMC8 Products

Bioinformatics Tool for ARMC8 Antibody (NBP1-69203)

Discover related pathways, diseases and genes to ARMC8 Antibody (NBP1-69203). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARMC8 Antibody (NBP1-69203)

Discover more about diseases related to ARMC8 Antibody (NBP1-69203).
 

Pathways for ARMC8 Antibody (NBP1-69203)

View related products by pathway.

PTMs for ARMC8 Antibody (NBP1-69203)

Learn more about PTMs related to ARMC8 Antibody (NBP1-69203).

Blogs on ARMC8

There are no specific blogs for ARMC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARMC8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARMC8