Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Rmnd5 protein at different developmental stages. Western blot analysis of embryo lysate from indicated stages (top). ...read more
Immunohistochemistry-Paraffin: RMND5A Antibody [NBP1-92337] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: RMND5A Antibody [NBP1-92337] - rmnd5 is expressed during early embryonic development. Temporal RT-PCR analysis of rmnd5 expression (top panel); different developmental stages (NF-stages) indicated at the ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Rmnd5 is part of an ubiquitin ligase complex. Glycerol step gradient of Xenopus laevis NF stage 36 embryo lysates. Molecular mass (MW) standard: albumin (67 kDa), fraction 1, ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, RMND5A, MAEA, ARMC8 & muskelin HEK293 CRISPR ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - V5-HA-tagged RanBP9 maintains its ability to interact with known members of the CTLH complex & Nucleolin. RanBP9 WT & TT immortalized Mouse Embryonic Fibroblasts (MEFs) were ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - RanBPM & TWA1 are essential for complex stability. Whole cell extracts prepared from control shRNA & RanBPM shRNA HEK293 cells (a), or from control (labelled as C), TWA1, ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - The CTLH complex has E3 ligase activity. (a) RanBPM immunocomplexes have E3 ligase activity that is dependent on RMND5A. Whole cell extracts prepared from wild type (WT; ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - C-Raf is regulated by the proteasome through the CTLH complex. Non-targeting shRNA control & shRNA RanBPM cells were treated with 10 μM MG132 or DMSO, as vehicle, for 24 h. ...read more
Western Blot: RMND5A Antibody [NBP1-92337] - Characterization of the CTLH complex. (a) Schematic representation of the CTLH complex. The model is adapted from the yeast Gid complex26. Note that the position of muskelin ...read more
Novus Biologicals Rabbit RMND5A Antibody - BSA Free (NBP1-92337) is a polyclonal antibody validated for use in IHC, WB and IP. Anti-RMND5A Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FDSDISSVGIDGCWQADSQRLLNEVMVEHFFRQGMLDVAE
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMND5A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Frog reactivity reported in scientific literature (PMID: 25793641), Mouse reactivity reported in scientific literature (bioRxiv, DOI:10.1101/745174)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for RMND5A Antibody - BSA Free
C-terminal to LisH motif, 44 kDa
CTLH
FLJ12753
FLJ13910
FLJ21795
MGC78451
p44CTLH
protein RMD5 homolog A
required for meiotic nuclear division 5 homolog A (S. cerevisiae)
RMD5
Background
RMND5A, also known as Protein RMD5 homolog A, consists of a 391 amino acid long isoform that is 44 kDa and a 98 amino acid short isoform that is 11 kDa, and it is involved in protein binding and required for meiotic nuclear division. Studies of RMND5A are being done on the following diseases and disorders: lissencephaly, malaria and ductus arteriosus. This protein has been known to have interactions with SHBG, SMAD9, C20orf11, GID8, POLR3H, YPEL4, RANBP9, MKLN1, KLHL2 and CCT3 proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Soliman S, Stark AE, Gardner M, Harshman SW Tagging allows faithful tracing of expression and enhances biochemical detection of Ran Binding Protein 9 in vivo bioRxiv (IP, Mouse)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our RMND5A Antibody - BSA Free and receive a gift card or discount.