GID4 Antibody

Images

 
Western Blot: C17orf39 Antibody [NBP1-53184] - Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GID4 Antibody Summary

Immunogen
Synthetic peptides corresponding to C17ORF39 The peptide sequence was selected from the C terminal of C17ORF39. Peptide sequence WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GID4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against C17orf39 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GID4 Antibody

  • C17orf39
  • chromosome 17 open reading frame 39
  • GID complex subunit 4, VID24 homolog (S. cerevisiae)
  • hypothetical protein LOC79018
  • MGC3048
  • VID24

Background

The exact function of C17orf39 remains unknown.The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13234
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92337
Species: Am, Hu, Mu
Applications: IHC, IHC-P, WB
H00025852-M01
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-83628
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-32596
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
AF7288
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP2-31361
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-85435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBL1-15012
Species: Hu
Applications: WB
NBP1-53184
Species: Hu
Applications: WB

Publications for GID4 Antibody (NBP1-53184) (0)

There are no publications for GID4 Antibody (NBP1-53184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GID4 Antibody (NBP1-53184) (0)

There are no reviews for GID4 Antibody (NBP1-53184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GID4 Antibody (NBP1-53184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GID4 Products

Bioinformatics Tool for GID4 Antibody (NBP1-53184)

Discover related pathways, diseases and genes to GID4 Antibody (NBP1-53184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GID4 Antibody (NBP1-53184)

Discover more about diseases related to GID4 Antibody (NBP1-53184).
 

Pathways for GID4 Antibody (NBP1-53184)

View related products by pathway.

PTMs for GID4 Antibody (NBP1-53184)

Learn more about PTMs related to GID4 Antibody (NBP1-53184).

Blogs on GID4

There are no specific blogs for GID4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GID4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GID4
Uniprot