Argininosuccinate Synthase Antibody


Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - ASS1 was successfully silenced in H4-II-E-C3 cells. Image from verified customer review.
Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining in human kidney and lymph node tissues using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same more
Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma more
Western Blot: Argininosuccinate Synthase Antibody [NBP1-88868] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for the same cell lines. Loading more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88868] - Staining of human lymph node shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Argininosuccinate Synthase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG
Specificity of human Argininosuccinate Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
Argininosuccinate Synthase Lysate (NBP2-64927)
Control Peptide
Argininosuccinate Synthase Protein (NBP1-88868PEP)
Reviewed Applications
Read 1 Review rated 4
NBP1-88868 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Argininosuccinate Synthase Antibody

  • argininosuccinate synthase 1
  • argininosuccinate synthase
  • argininosuccinate synthetase 1
  • argininosuccinate synthetase
  • citrulline-aspartate ligase
  • Citrulline--aspartate ligase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Argininosuccinate Synthase Antibody (NBP1-88868) (0)

There are no publications for Argininosuccinate Synthase Antibody (NBP1-88868).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Argininosuccinate Synthase Antibody (NBP1-88868) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-88868:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Western Blot Argininosuccinate Synthase NBP1-88868
reviewed by:
WB Rat 03/08/2018


ApplicationWestern Blot
Sample TestedH4-II-E-C3 rat hepatoma cell line

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Argininosuccinate Synthase Antibody (NBP1-88868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Argininosuccinate Synthase Products

Bioinformatics Tool for Argininosuccinate Synthase Antibody (NBP1-88868)

Discover related pathways, diseases and genes to Argininosuccinate Synthase Antibody (NBP1-88868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Synthase Antibody (NBP1-88868)

Discover more about diseases related to Argininosuccinate Synthase Antibody (NBP1-88868).

Pathways for Argininosuccinate Synthase Antibody (NBP1-88868)

View related products by pathway.

PTMs for Argininosuccinate Synthase Antibody (NBP1-88868)

Learn more about PTMs related to Argininosuccinate Synthase Antibody (NBP1-88868).

Blogs on Argininosuccinate Synthase

There are no specific blogs for Argininosuccinate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: WB
Species: Rat


Gene Symbol ASS1