Ornithine Carbamoyltransferase Antibody

Images

 
Western Blot: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Analysis in human liver tissue.
Immunocytochemistry/ Immunofluorescence: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunohistochemical staining of human kidney shows no positivity as expected.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunohistochemical staining of human liver cancer shows moderate to strong cytoplasmic positivity in tumor cells.
Immunohistochemistry-Paraffin: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Immunohistochemical staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Simple Western lane view shows a specific band for OTC in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using ...read more
Simple Western: Ornithine Carbamoyltransferase Antibody [NBP1-87408] - Electropherogram image(s) of corresponding Simple Western lane view. Ornithine Carbamoyltransferase antibody was used at 1:20 dilution on Liver ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ornithine Carbamoyltransferase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OTC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Ornithine Carbamoyltransferase Protein (NBP1-87408PEP)
Publications
Read Publications using NBP1-87408.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ornithine Carbamoyltransferase Antibody

  • EC 2.1.3
  • EC 2.1.3.3
  • MGC129967
  • MGC129968
  • MGC138856
  • OCTD
  • ornithine carbamoyltransferase
  • ornithine carbamoyltransferase, mitochondrial
  • Ornithine transcarbamylase
  • OTCase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000435-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
AF2009
Species: Hu
Applications: WB, IHC
AF7895
Species: Hu
Applications: WB, IHC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NBP2-12553
Species: Hu
NBP1-84412
Species: Hu
Applications: IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34980
Species: Hu
NBP1-54755
Species: Hu
Applications: WB
NBP2-32887
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE, IF
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NBP1-87408
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for Ornithine Carbamoyltransferase Antibody (NBP1-87408)(2)

Reviews for Ornithine Carbamoyltransferase Antibody (NBP1-87408) (0)

There are no reviews for Ornithine Carbamoyltransferase Antibody (NBP1-87408). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ornithine Carbamoyltransferase Antibody (NBP1-87408) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ornithine Carbamoyltransferase Products

Bioinformatics Tool for Ornithine Carbamoyltransferase Antibody (NBP1-87408)

Discover related pathways, diseases and genes to Ornithine Carbamoyltransferase Antibody (NBP1-87408). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ornithine Carbamoyltransferase Antibody (NBP1-87408)

Discover more about diseases related to Ornithine Carbamoyltransferase Antibody (NBP1-87408).
 

Pathways for Ornithine Carbamoyltransferase Antibody (NBP1-87408)

View related products by pathway.

PTMs for Ornithine Carbamoyltransferase Antibody (NBP1-87408)

Learn more about PTMs related to Ornithine Carbamoyltransferase Antibody (NBP1-87408).

Blogs on Ornithine Carbamoyltransferase

There are no specific blogs for Ornithine Carbamoyltransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ornithine Carbamoyltransferase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OTC