Argininosuccinate Synthase Antibody

Images

 
Orthogonal Strategies: Western Blot: Argininosuccinate Synthase Antibody [NBP1-88867] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human skin shows strong cytoplasmic positivity in a subset of squamous epithelial cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining in human kidney and lymph node tissues using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney, liver, lymph node and urinary bladder using Anti-ASS1 antibody NBP1-88867 (A) ...read more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human liver.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human urinary bladder.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney using Anti-ASS1 antibody NBP1-88867.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human lymph node using Anti-ASS1 antibody NBP1-88867.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Analysis in human kidney and lymph node tissues using NBP1-88867 antibody. Corresponding ASS1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney shows strong cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney, liver, lymph node and skin using Anti-ASS1 antibody NBP1-88867 (A) shows similar protein distribution across ...read more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human lymph node shows no cytoplasmic positivity in germinal center cells as expected.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Argininosuccinate Synthase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ASS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Argininosuccinate Synthase Protein (NBP1-88867PEP)
Publications
Read Publication using NBP1-88867.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Argininosuccinate Synthase Antibody

  • argininosuccinate synthase 1
  • argininosuccinate synthase
  • argininosuccinate synthetase 1
  • argininosuccinate synthetase
  • ASSCTLN1
  • citrulline-aspartate ligase
  • Citrulline--aspartate ligase
  • EC 6.3.4.5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87462
Species: Ca, Hu
Applications: IHC, IHC-P, WB
NBP1-87408
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
NBP2-03107
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33380
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-86615
Species: Hu
Applications: IHC, IHC-P, WB
AF5414
Species: Hu
Applications: Simple Western, WB
210-TA
Species: Hu
Applications: BA
NBP1-32731
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Argininosuccinate Synthase Antibody (NBP1-88867)(1)

Reviews for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no reviews for Argininosuccinate Synthase Antibody (NBP1-88867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Argininosuccinate Synthase Products

Bioinformatics Tool for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover related pathways, diseases and genes to Argininosuccinate Synthase Antibody (NBP1-88867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover more about diseases related to Argininosuccinate Synthase Antibody (NBP1-88867).
 

Pathways for Argininosuccinate Synthase Antibody (NBP1-88867)

View related products by pathway.

PTMs for Argininosuccinate Synthase Antibody (NBP1-88867)

Learn more about PTMs related to Argininosuccinate Synthase Antibody (NBP1-88867).
 

Research Areas for Argininosuccinate Synthase Antibody (NBP1-88867)

Find related products by research area.

Blogs on Argininosuccinate Synthase

There are no specific blogs for Argininosuccinate Synthase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Argininosuccinate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ASS1