Argininosuccinate Synthase Antibody


Western Blot: Argininosuccinate Synthase Antibody [NBP1-88867] - Analysis in control (vector only transfected HEK293T lysate) and ASS1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human liver.
Orthogonal Strategies: Western Blot: Argininosuccinate Synthase Antibody [NBP1-88867] - Analysis in human cell lines MCF-7 and U-251MG using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human lymph node shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining in human kidney and lymph node tissues using anti-ASS1 antibody. Corresponding ASS1 RNA-seq data more
Independent Antibodies: Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney, liver, lymph node and urinary bladder using Anti-ASS1 antibody NBP1-88867 (A) more
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human urinary bladder.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Argininosuccinate Synthase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
Specificity of human Argininosuccinate Synthase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Argininosuccinate Synthase Knockout HeLa Cell Lysate
Control Peptide
Read Publication using NBP1-88867.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Argininosuccinate Synthase Antibody

  • argininosuccinate synthase 1
  • argininosuccinate synthase
  • argininosuccinate synthetase 1
  • argininosuccinate synthetase
  • citrulline-aspartate ligase
  • Citrulline--aspartate ligase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
Species: Hu, Mu, GP
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Argininosuccinate Synthase Antibody (NBP1-88867)(1)

Reviews for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no reviews for Argininosuccinate Synthase Antibody (NBP1-88867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Argininosuccinate Synthase Products

Bioinformatics Tool for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover related pathways, diseases and genes to Argininosuccinate Synthase Antibody (NBP1-88867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover more about diseases related to Argininosuccinate Synthase Antibody (NBP1-88867).

Pathways for Argininosuccinate Synthase Antibody (NBP1-88867)

View related products by pathway.

PTMs for Argininosuccinate Synthase Antibody (NBP1-88867)

Learn more about PTMs related to Argininosuccinate Synthase Antibody (NBP1-88867).

Blogs on Argininosuccinate Synthase

There are no specific blogs for Argininosuccinate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Argininosuccinate Synthase Antibody and receive a gift card or discount.


Gene Symbol ASS1