Argininosuccinate Synthase Antibody


Western Blot: Argininosuccinate Synthase Antibody [NBP1-88867] - Analysis in human cell line THP-1.
Immunocytochemistry/ Immunofluorescence: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human cell line A-431 shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: Argininosuccinate Synthase Antibody [NBP1-88867] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

Argininosuccinate Synthase Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVFIEDVSREFVEEFIWPAIQS
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Argininosuccinate Synthase Protein (NBP1-88867PEP)
Read Publication using NBP1-88867.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Argininosuccinate Synthase Antibody

  • argininosuccinate synthase 1
  • argininosuccinate synthase
  • argininosuccinate synthetase 1
  • argininosuccinate synthetase
  • citrulline-aspartate ligase
  • Citrulline--aspartate ligase
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-Fr
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC

Publications for Argininosuccinate Synthase Antibody (NBP1-88867)(1)

Reviews for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no reviews for Argininosuccinate Synthase Antibody (NBP1-88867). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Argininosuccinate Synthase Antibody (NBP1-88867) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Argininosuccinate Synthase Products

Bioinformatics Tool for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover related pathways, diseases and genes to Argininosuccinate Synthase Antibody (NBP1-88867). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Argininosuccinate Synthase Antibody (NBP1-88867)

Discover more about diseases related to Argininosuccinate Synthase Antibody (NBP1-88867).

Pathways for Argininosuccinate Synthase Antibody (NBP1-88867)

View related products by pathway.

PTMs for Argininosuccinate Synthase Antibody (NBP1-88867)

Learn more about PTMs related to Argininosuccinate Synthase Antibody (NBP1-88867).

Blogs on Argininosuccinate Synthase

There are no specific blogs for Argininosuccinate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Argininosuccinate Synthase Antibody and receive a gift card or discount.


Gene Symbol ASS1