We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Arginase 1/ARG1/liver Arginase Antibody - BSA Free

Images

 
Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Simple Western lane view shows a specific band for ARG1 in 0.2 mg/ml of Liver (left), HepG2 (right) lysate. This experiment was performed under ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining in human liver and kidney tissues . Corresponding ARG1 RNA-seq data are presented for the same ...read more
Independent Antibodies: Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Analysis using Anti-ARG1 antibody NBP1-87490 (A) shows similar pattern to independent antibody NBP1-87455 (B).
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human bone marrow shows strong cytoplasmic and nuclear positivity in a subset of hematopoietic cells.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human hepatocellular carcinoma shows moderate cytoplasmic and nuclear positivity in tumor cells.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human kidney shows no positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.
Simple Western: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87490] - Electropherogram image(s) of corresponding Simple Western lane view. Arginase 1/ARG1/liver Arginase antibody was used at 1:50 dilution on Liver and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Arginase 1/ARG1/liver Arginase Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Simple Western 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in Liver, HepG2, separated by Size, antibody dilution of 1:50, apparent MW was 41 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
Arginase 1/ARG1/liver Arginase Recombinant Protein Antigen (NBP1-87490PEP)
Publications
Read Publications using NBP1-87490.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (81%). Reactivity reported in scientific literature (PMID: 18715028)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Arginase 1/ARG1/liver Arginase Antibody - BSA Free

  • AI
  • ARG1
  • Arginase 1
  • arginase, liver
  • Arginase-1
  • EC 3.5.3.1
  • EC:3.5.3.1
  • Liver Arginase
  • Liver-type arginase
  • PGIF
  • Type I Arginase

Background

Arginase 1 (ARG1), also known as liver arginase, is a metalloenzyme that is a member of the ureohydrolase superfamily and arginase family (1). ARG1 is known for its role in the urea cycle in catalyzing the conversion of L-arginine into urea and L-ornithine (1). Arginase has two distinct isoforms, with ARG1 being expressed primarily in the liver and ARG2 in extrahepatic tissues (1). Human ARG1 is synthesized as 322 amino acids (aa) in length with a theoretical molecular weight of 35 kDa (1,2). Three ARG1 monomers can form a highly active homotrimer of 105 kDa (1). A key structural feature of the arginase protein is the binuclear magnesium (Mn2+) ions at its core (1).

Arginase and nitric oxidase synthase (NOS) compete for the same L-arginine substrate, creating a delicate balance between pathways (1). Furthermore, bioavailability of L-arginine and ARG1 expression has been implicated in several pathologies including vascular disease, neuronal disease, cardiovascular disease, immune dysfunction, inflammation, and cancer (1,3-5). For instance, ARG1 functions as a macrophage marker, defining the M2 population, while inducible nitric oxide synthase (iNOS) characterizes the M1 population; impaired M1/M2 polarization and changes in ARG1 expression is observed in diseases such as arteriogenesis, asthma, pulmonary fibrosis, and inflammatory bowel disease (1,3). In humans, arginase deficiency, known as argininemia, is an autosomal recessive metabolic disorder characterized by elevated ammonia (hyperammonemia) levels and arginine accumulation (6). Given that many arginase-associated diseases are characterized by upregulation in expression of ARG1, ARG2, or both, arginase inhibitors are currently being studied as a potential therapeutic approach (1,4).

References

1. S Clemente, G., van Waarde, A., F Antunes, I., Domling, A., & H Elsinga, P. (2020). Arginase as a Potential Biomarker of Disease Progression: A Molecular Imaging Perspective. International Journal of Molecular Sciences. https://doi.org/10.3390/ijms21155291

2. Uniprot (P05089)

3. Kieler, M., Hofmann, M., & Schabbauer, G. (2021). More than just protein building blocks: How amino acids and related metabolic pathways fuel macrophage polarization. The FEBS Journal. Advance online publication. https://doi.org/10.1111/febs.15715

4. Shosha, E., Fouda, A. Y., Narayanan, S. P., Caldwell, R. W., & Caldwell, R. B. (2020). Is the Arginase Pathway a Novel Therapeutic Avenue for Diabetic Retinopathy?. Journal of Clinical Medicine. https://doi.org/10.3390/jcm9020425

5. Correale J. (2021). Immunosuppressive Amino-Acid Catabolizing Enzymes in Multiple Sclerosis. Frontiers in Immunology. https://doi.org/10.3389/fimmu.2020.600428

6. Morales, J. A., & Sticco, K. L. (2020). Arginase Deficiency. In StatPearls. StatPearls Publishing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, WB
DY417
Species: Mu
Applications: ELISA
6507-IL/CF
Species: Hu
Applications: BA
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76917
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
DY413
Species: Mu
Applications: ELISA
M6000B
Species: Mu
Applications: ELISA
NBP2-46539
Species: Ca, Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
DCP00
Species: Hu
Applications: ELISA
NBP1-88868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF2167
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, Simple Western, WB
NBP1-87466
Species: Hu
Applications: IHC,  IHC-P
NBP1-87490
Species: Hu
Applications: WB, Simple Western, IHC

Publications for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87490)(6)

Reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87490) (0)

There are no reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginase 1/ARG1/liver Arginase Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ARG1