Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor 1 Antibody [NBP1-87466] - Staining of human dissociated rat hippocampal culture. Image courtesy of Janosch Heller, University College London.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1:10-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC data from customer review.
Control Peptide
Muscarinic Acetylcholine Receptor M1/CHRM1 Protein (NBP1-87466PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87466 in the following applications:

Publications
Read Publication using
NBP1-87466 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 24658304).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

  • cholinergic receptor, muscarinic 1
  • CHRM1
  • HM1
  • M1
  • M1R
  • mAChR M1
  • MGC30125
  • muscarinic acetylcholine receptor M1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NB120-2805
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-87466
Species: Hu, Rt, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Review for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.
We have 1 review tested in 1 application: ICC.

Reviews using NBP1-87466:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Muscarinic Acetylcholine Receptor M1/CHRM1 NBP1-87466
Enlarge
reviewed by:
Anony- mous
ICC Rat 08/27/2014
View

Summary

ApplicationImmunocytochemistry
SpeciesRat
Special ApplicationsReview courtesy of Janosch Heller, University College London
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M1/CHRM1 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466).
 

Pathways for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

View related products by pathway.

PTMs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Learn more about PTMs related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466).
 

Research Areas for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M1/CHRM1

There are no specific blogs for Muscarinic Acetylcholine Receptor M1/CHRM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anony- mous
08/27/2014
Application: ICC
Species: Rat

Bioinformatics

Gene Symbol CHRM1
Entrez