Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining in human cerebral cortex and pancreas tissues using anti-CHRM1 antibody. ...read more
Immunocytochemistry/ Immunofluorescence: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of dissociated rat hippocampal culture. Image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody [NBP1-87466] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SETPGKGGGSSSSSERSQPGAEGSPETPPGRCCRCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEVVIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry Free-Floating
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/mL
Application Notes
Use in IHC-Fr, WB reported in scientific literature (PMID: 24658304). Use in IHC-FrFl reported in scientific literature (PMID: 31785263). For IHC-Paraffin, HIER pH 6 retrieval is recommended. This Muscarinic Acetylcholine Receptor M1/CHRM1 antibody is validated for ICC/IF from a verified customer review.
Control Peptide
Muscarinic Acetylcholine Receptor M1/CHRM1 Protein (NBP1-87466PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87466 in the following applications:

Publications
Read Publications using
NBP1-87466 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 31785263). Use in Rat reported in scientific literature (PMID:31785263).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody

  • cholinergic receptor, muscarinic 1
  • CHRM1
  • HM1
  • M1
  • M1R
  • mAChR M1
  • MGC30125
  • muscarinic acetylcholine receptor M1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IM, IP, Simple Western, WB
NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NLS1333
Species: Bv, Ca, Eq, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-72961
Species: Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB
AF952
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
DY417
Species: Mu
Applications: ELISA
NB100-64848
Species: Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP2-92630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-38323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl

Publications for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)(3)

We have publications tested in 3 confirmed species: Human, Mouse, Rat.

We have publications tested in 3 applications: ICC/IF, IHC-Fr, IHC-FrFl.


Filter By Application
ICC/IF
(1)
IHC-Fr
(1)
IHC-FrFl
(1)
All Applications
Filter By Species
Human
(2)
Mouse
(1)
Rat
(1)
All Species

Review for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Rat.

Reviews using NBP1-87466:
Filter by Applications
ICC
(1)
All Applications
Filter by Species
Rat
(1)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry Muscarinic Acetylcholine Receptor M1/CHRM1 NBP1-87466
Enlarge
4
reviewed by:
Bryan Tinsley
ICC Rat 08/27/2014
View

Summary

ApplicationImmunocytochemistry
SpeciesRat
Special ApplicationsReview courtesy of Janosch Heller, University College London
FileView PDF

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Muscarinic Acetylcholine Receptor M1/CHRM1 Products

Bioinformatics Tool for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Discover related pathways, diseases and genes to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Discover more about diseases related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466).
 

Pathways for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

View related products by pathway.

PTMs for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Learn more about PTMs related to Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466).
 

Research Areas for Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody (NBP1-87466)

Find related products by research area.

Blogs on Muscarinic Acetylcholine Receptor M1/CHRM1

There are no specific blogs for Muscarinic Acetylcholine Receptor M1/CHRM1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Bryan Tinsley
08/27/2014
Application: ICC
Species: Rat

Bioinformatics

Gene Symbol CHRM1