Arginase 1/ARG1/liver Arginase Antibody

Images

 
Western Blot: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87455] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma ...read more
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody [NBP1-87455] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Arginase 1/ARG1/liver Arginase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Arginase 1/ARG1/liver Arginase Protein (NBP1-87455PEP)
Publications
Read Publications using
NBP1-87455 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23243594)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Arginase 1/ARG1/liver Arginase Antibody

  • AI
  • ARG1
  • Arginase 1
  • arginase, liver
  • Arginase-1
  • EC 3.5.3.1
  • Liver Arginase
  • Liver-type arginase
  • PGIF
  • Type I Arginase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-87455
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)(3)

Reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455) (0)

There are no reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arginase 1/ARG1/liver Arginase Products

Bioinformatics Tool for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)

Discover related pathways, diseases and genes to Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)

Discover more about diseases related to Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455).
 

Pathways for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)

View related products by pathway.

PTMs for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)

Learn more about PTMs related to Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455).
 

Research Areas for Arginase 1/ARG1/liver Arginase Antibody (NBP1-87455)

Find related products by research area.

Blogs on Arginase 1/ARG1/liver Arginase

There are no specific blogs for Arginase 1/ARG1/liver Arginase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginase 1/ARG1/liver Arginase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARG1
Entrez