Arginase 1/ARG1/liver Arginase Antibody (CL0186)

Images

 
Western Blot: Arginase 1/ARG1/liver Arginase Antibody (CL0186) [NBP2-14787] - Lane 1: Marker [kDa], Lane 2: Human liver tissue lysate
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody (CL0186) [NBP2-14787] - Staining of human prostate shows no immunoreactivity (negative control).
Immunohistochemistry-Paraffin: Arginase 1/ARG1/liver Arginase Antibody (CL0186) [NBP2-14787] - Staining of human liver shows strong nuclear and cytoplasmic positivity in hepatocytes.
Simple Western: Arginase 1/ARG1/liver Arginase Antibody (CL0186) [NBP2-14787] - Simple Western lane view shows a specific band for ARG1 in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing ...read more
Simple Western: Arginase 1/ARG1/liver Arginase Antibody (CL0186) [NBP2-14787] - Electropherogram image(s) of corresponding Simple Western lane view. Arginase 1/ARG1/liver Arginase antibody was used at 1:20 dilution on ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clone
CL0186
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Arginase 1/ARG1/liver Arginase Antibody (CL0186) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
ARG1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000 - 1:2500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:2500-1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Reactivity Notes

Mouse(82%), Rat(81%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Arginase 1/ARG1/liver Arginase Antibody (CL0186)

  • AI
  • ARG1
  • Arginase 1
  • arginase, liver
  • Arginase-1
  • EC 3.5.3.1
  • Liver Arginase
  • Liver-type arginase
  • PGIF
  • Type I Arginase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46539
Species: Hu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-204
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-14787
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P

Publications for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787) (0)

There are no publications for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787) (0)

There are no reviews for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Arginase 1/ARG1/liver Arginase Products

Bioinformatics Tool for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787)

Discover related pathways, diseases and genes to Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787)

Discover more about diseases related to Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787).
 

Pathways for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787)

View related products by pathway.

PTMs for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787)

Learn more about PTMs related to Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787).
 

Research Areas for Arginase 1/ARG1/liver Arginase Antibody (NBP2-14787)

Find related products by research area.

Blogs on Arginase 1/ARG1/liver Arginase

There are no specific blogs for Arginase 1/ARG1/liver Arginase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Arginase 1/ARG1/liver Arginase Antibody (CL0186) and receive a gift card or discount.

Bioinformatics

Gene Symbol ARG1
Entrez