ARA54 Antibody

Images

 
Western Blot: ARA54 Antibody [H00009604-D01P] - Analysis of RNF14 expression in transfected 293T cell line by RNF14 polyclonal antibody.Lane 1: RNF14 transfected lysate(39.60 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: ARA54 Antibody [H00009604-D01P] - Analysis of antibody to RNF14 on HeLa cell. Antibody concentration 30 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARA54 Antibody Summary

Immunogen
RNF14 (NP_899645.1, 1 a.a. - 348 a.a.) full-length human protein. MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Specificity
RNF14 - ring finger protein 14,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RNF14
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ARA54 Antibody

  • Androgen receptor-associated protein 54
  • ARA54
  • ARA54androgen receptor associated protein 54
  • EC 6.3.2.-
  • HFB30
  • HFB30E3 ubiquitin-protein ligase RNF14
  • ring finger protein 14FLJ26004
  • RNF14
  • Triad2 protein
  • TRIAD2

Background

The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARA54 Antibody (H00009604-D01P) (0)

There are no publications for ARA54 Antibody (H00009604-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARA54 Antibody (H00009604-D01P) (0)

There are no reviews for ARA54 Antibody (H00009604-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARA54 Antibody (H00009604-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARA54 Products

Research Areas for ARA54 Antibody (H00009604-D01P)

Find related products by research area.

Blogs on ARA54

There are no specific blogs for ARA54, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARA54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RNF14
Entrez
Uniprot