ARA54 Antibody (4X10Q6)

Western Blot: ARA54 Antibody (4X10Q6) [NBP3-33230] - Western blot analysis of various lysates using ARA54 Rabbit mAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 4X10Q6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

ARA54 Antibody (4X10Q6) Summary

• Description: Novus Biologicals Rabbit ARA54 Antibody (4X10Q6) (NBP3-33230) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ARA54 (Q9UBS8).
  
  Sequence:
  LDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKN
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: RNF14
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 54 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ARA54 Antibody (4X10Q6)

• Androgen receptor-associated protein 54
• ARA54
• ARA54androgen receptor associated protein 54
• EC 6.3.2.-
• HFB30
• HFB30E3 ubiquitin-protein ligase RNF14
• ring finger protein 14FLJ26004
• RNF14
• Triad2 protein
• TRIAD2

Background

RNF14 is encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate. A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer. This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins. Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RNF14