Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

Western Blot: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Analysis in human cell line RT-4 and human cell line U-251 MG.

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Apolipoprotein E R2/ApoE R2 Antibody [NBP2-62680] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Apolipoprotein E R2/ApoE R2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HIGRTAQIGHVYPAAISSFDRPLWAEPCLGETREPEDPAPALKELFVLPGEPRSQLHQLPKNPLSELPVVKSKRVALSLEDDGLP
• Predicted Species: Mouse (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LRP8
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Apolipoprotein E R2/ApoE R2 Recombinant Protein Antigen (NBP2-62680PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for Apolipoprotein E R2/ApoE R2 Antibody - BSA Free

• ApoER2
• APOER2HSZ75190
• Apolipoprotein E R2
• Apolipoprotein E receptor 2
• low density lipoprotein receptor-related protein 8, apolipoprotein e receptor
• low-density lipoprotein receptor-related protein 8
• Lr8b
• LRP8
• LRP-8
• MCI1

Background

Apolipoprotein E Receptor 2 (ApoER2), also known as LRP8, is a Low-density lipoprotein receptor family member involved in endocytosis and signal transduction. Specifically, ApoER-2 is responsible for the cellular recognition and internalization of ApoE containing lipoproteins, including VLDL and HDL.

ApoER2 is expressed mainly in the brain, placenta, platelets and megakaryocytic cells, but not in the liver. LRP8 mutations can cause myocardial infarction type 1 (MCI1), a condition characterized by the irreversible necrosis of heart muscle secondary to prolonged ischemia. ApoER2 may also play a role in debilitating neurodegenerative diseases such as schizophrenia and Alzheimer's disease.

ApoER2 antibodies are useful tools for studying certian cardiac and neurodegenerative diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LRP8