Immunocytochemistry/ Immunofluorescence: OMA1 Antibody [NBP2-30971] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human testis shows moderate granular cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human colon shows weak to moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human lymphoid tissues shows moderate granular cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: OMA1 Antibody [NBP2-30971] - Staining of human pancreas shows low positivity in exocrine glandular cells as expected.
This antibody was developed against a recombinant protein corresponding to amino acids: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OMA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for OMA1 Antibody
2010001O09Rik
DAB1
EC 3.4.24.-
metalloprotease related protein 1
Metalloprotease-related protein 1
MPRP1
MPRP-1mitochondrial
OMA1 homolog, zinc metallopeptidase (S. cerevisiae)
overlapping activity with M-AAA protease
YKR087C
ZMPOMA1
Background
OMA1, also known as Metalloendopeptidase OMA1, mitochondrial, has 2 isoforms, a 524 amino acid long isoform that is 60 kDa and a short 486 amino acid isoform that is 56 kDa; widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver; participates in the quality control system in the inner membrane of mitochondria following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Studies are being performed on the relationship of this protein to amyotrophic lateral sclerosis, lateral sclerosis, childhood medulloblastoma, and medulloblastoma. OMA1 protein involvement has been observed with relation to diet induced thermogenesis, glucose metabolic process, misfolded or incompletely synthesized protein catabolic process, lipid metabolic process, negative regulation of mitochondrial fusion, and cristae formation processes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for OMA1 Antibody (NBP2-30971)
Discover related pathways, diseases and genes to OMA1 Antibody (NBP2-30971). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for OMA1 Antibody (NBP2-30971)
Discover more about diseases related to OMA1 Antibody (NBP2-30971).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our OMA1 Antibody and receive a gift card or discount.