APOB48R Antibody

Images

 
Immunohistochemistry: APOB48R Antibody [NBP1-90130] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

APOB48R Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APOBR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
APOB48R Protein (NBP1-90130PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for APOB48R Antibody

  • APOB100R
  • apoB-48R
  • APOB48Rapolipoprotein B48 receptor
  • apolipoprotein B receptor
  • Apolipoprotein B-100 receptor
  • Apolipoprotein B-48 receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-527
Species: Hu, Mu
Applications: WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5175
Species: Mu
Applications: WB, IHC
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90130
Species: Hu
Applications: IHC, IHC-P

Publications for APOB48R Antibody (NBP1-90130) (0)

There are no publications for APOB48R Antibody (NBP1-90130).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for APOB48R Antibody (NBP1-90130) (0)

There are no reviews for APOB48R Antibody (NBP1-90130). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for APOB48R Antibody (NBP1-90130) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional APOB48R Products

Bioinformatics Tool for APOB48R Antibody (NBP1-90130)

Discover related pathways, diseases and genes to APOB48R Antibody (NBP1-90130). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on APOB48R

There are no specific blogs for APOB48R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our APOB48R Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APOBR