![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human colon, liver, lymph node and spleen using Anti-APOBR antibody NBP1-90130 (A) shows similar protein distribution across tissues to independent antibody NBP1-90129 (B).](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0007.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human colon, liver, lymph node and spleen using Anti-APOBR antibody NBP1-90130 (A) shows similar protein distribution across tissues to independent antibody NBP1-90129 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit APOB48R Antibody - BSA Free (NBP1-90130) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APOBR |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | APOBR |
![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining in human spleen and liver tissues using anti-APOBR antibody. Corresponding APOBR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0006.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining in human spleen and liver tissues using anti-APOBR antibody. Corresponding APOBR RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human spleen shows high expression.](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0008.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human spleen shows high expression.")
![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0005.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human colon.](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0009.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human colon.")
![Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human lymph node.](http://images.novusbio.com/fullsize/APOB48R-Antibody-Immunohistochemistry-Paraffin-NBP1-90130-img0010.jpg "Immunohistochemistry-Paraffin: APOB48R Antibody [NBP1-90130] - Staining of human lymph node.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunohistochemistry LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDL_R_AF2255_Immunohistochemistry_7149.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images2/LDLR_AF2255_Western_Blot_23731.jpg)
![Western Blot LDLR Antibody [Unconjugated]](https://images.novusbio.com/images/af2255_mouse-ldl-r-affinity-purified-polyclonal-ab-4120241049445.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")