Apelin Antibody

Images

 
Western Blot: Apelin Antibody [H00008862-D01P] - Analysis of APLN expression in transfected 293T cell line by APLN polyclonal antibody.Lane 1: APLN transfected lysate(13.53 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Apelin Antibody Summary

Immunogen
APLN (AAH21104.1, 1 a.a. - 122 a.a.) full-length human protein. MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Specificity
APLN - apelin, AGTRL1 ligand,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
APLN
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Apelin Antibody

  • AGTRL1 ligand
  • AGTRL1 Lligand
  • APEL
  • Apelin
  • apelin, AGTRL1 ligand
  • APJ endogenous ligand
  • APLN
  • XNPEP2

Background

Apelin is a neuropeptide expressed in the supraoptic and paraventricular nuclei that acts on specific receptors located on vasopressinergic neurons (De Mota et al., 2004) [PubMed 15231996].[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB856
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-594
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
7270-IL/CF
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-60645
Species: Hu
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for Apelin Antibody (H00008862-D01P) (0)

There are no publications for Apelin Antibody (H00008862-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Apelin Antibody (H00008862-D01P) (0)

There are no reviews for Apelin Antibody (H00008862-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Apelin Antibody (H00008862-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Apelin Antibody (H00008862-D01P)

Discover related pathways, diseases and genes to Apelin Antibody (H00008862-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Apelin Antibody (H00008862-D01P)

Discover more about diseases related to Apelin Antibody (H00008862-D01P).
 

Pathways for Apelin Antibody (H00008862-D01P)

View related products by pathway.

PTMs for Apelin Antibody (H00008862-D01P)

Learn more about PTMs related to Apelin Antibody (H00008862-D01P).

Blogs on Apelin

There are no specific blogs for Apelin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Apelin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol APLN
Entrez
Uniprot