Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free

Western Blot: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-89087] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-89087] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-89087] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-89087] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Angiopoietin-like Protein 3/ANGPTL3 Antibody [NBP1-89087] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRT
• Predicted Species: Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANGPTL3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free

• AGNPT5
• Ang-5
• angiopoietin 5
• Angiopoietin-5
• angiopoietin-like 3
• Angiopoietin-like Protein 3
• angiopoietin-related protein 3
• ANGPT5angiopoietin-5
• ANGPTL3
• FHBL2

Background

ANGPTL3 is a 460 amino acid protein that is found most commonly in the liver, but has also been shown to reside in kidney samples, and contains three domains consisting of a signal peptide, N-terminal coiled-coil and C-terminal Fibrinogen (FBN) like domain. This protein is involved with the lipid metabolism disease pathways in relation to low levels of LDL (low density lipoproteins), HDL (High density lipoproteins), and triglycerides in plasma. This protein plays a role in angiogenesis and has been shown to interact with ITGAV, ITGB3, and ITGA5, and work is being done to study the protein and the related hypobetalipoproteinemia and atherosclerosis involvement.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANGPTL3
• Entrez:
  • 27329(Human)
• Uniprot:
  • Q9Y5C1(Human)