Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free (NBP1-89087) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRT |
| Predicted Species |
Mouse (91%), Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ANGPTL3 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for Angiopoietin-like Protein 3/ANGPTL3 Antibody - BSA Free
Background
ANGPTL3 is a 460 amino acid protein that is found most commonly in the liver, but has also been shown to reside in kidney samples, and contains three domains consisting of a signal peptide, N-terminal coiled-coil and C-terminal Fibrinogen (FBN) like domain. This protein is involved with the lipid metabolism disease pathways in relation to low levels of LDL (low density lipoproteins), HDL (High density lipoproteins), and triglycerides in plasma. This protein plays a role in angiogenesis and has been shown to interact with ITGAV, ITGB3, and ITGA5, and work is being done to study the protein and the related hypobetalipoproteinemia and atherosclerosis involvement.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Simple Western, WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Mu
Applications: ICC, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Ha, Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, IHC
Publications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087) (0)
There are no publications for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087) (0)
There are no reviews for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Angiopoietin-like Protein 3/ANGPTL3 Products
Research Areas for Angiopoietin-like Protein 3/ANGPTL3 Antibody (NBP1-89087)
Find related products by research area.
|
Blogs on Angiopoietin-like Protein 3/ANGPTL3