TRIB1 Antibody

Images

 
Western Blot: TRIB1 Antibody [NBP1-55386] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Intestine
Immunocytochemistry/ Immunofluorescence: TRIB1 Antibody [NBP1-55386] - Formalin Fixed Paraffin; Embedded Tissue: Human Lung Tissue; Observed Staining: Cytoplasmic in alveolar type I & II cells; Primary Antibody ...read more
Western Blot: TRIB1 Antibody [NBP1-55386] - COLO205, Antibody Dilution: 1.0 ug/ml TRIB1 is supported by BioGPS gene expression data to be expressed in COLO205.
Western Blot: TRIB1 Antibody [NBP1-55386] - Sample Tissue: Human Stomach Tumor Antibody Dilution: 1.0 ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Eq, Gp, Rb, YeSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIB1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRIB1(tribbles homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of TRIB1 (NP_079471). Peptide sequence TEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKA. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Equine (100%), Yeast (100%), Bovine (100%), Guinea Pig (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
  • Immunocytochemistry/Immunofluorescence 1:100 -1:200
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRIB1 Antibody

  • C8FWG-protein-coupled receptor induced protein
  • GIG-2
  • GIG2G-protein-coupled receptor-induced protein 2
  • G-protein-coupled receptor-induced gene 2 protein
  • SKIP1
  • TRB-1
  • TRB1phosphoprotein regulated by mitogenic pathways
  • tribbles homolog 1 (Drosophila)
  • tribbles homolog 1
  • tribbles-like protein 1

Background

TRIB1 interacts with MAPK kinases and regulates activation of MAP kinases. TRIB1 may not display kinase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00028951-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF7507
Species: Hu
Applications: WB, ICC
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
NBP1-31234
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-609
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03396
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19860
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03263
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB200-527
Species: Hu, Mu, Rt
Applications: WB, IP
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP, KO
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-55386
Species: Hu, Mu, Rt, Bv, Eq, Gp, Rb, Ye
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIB1 Antibody (NBP1-55386) (0)

There are no publications for TRIB1 Antibody (NBP1-55386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIB1 Antibody (NBP1-55386) (0)

There are no reviews for TRIB1 Antibody (NBP1-55386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIB1 Antibody (NBP1-55386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TRIB1 Products

Bioinformatics Tool for TRIB1 Antibody (NBP1-55386)

Discover related pathways, diseases and genes to TRIB1 Antibody (NBP1-55386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIB1 Antibody (NBP1-55386)

Discover more about diseases related to TRIB1 Antibody (NBP1-55386).
 

Pathways for TRIB1 Antibody (NBP1-55386)

View related products by pathway.

PTMs for TRIB1 Antibody (NBP1-55386)

Learn more about PTMs related to TRIB1 Antibody (NBP1-55386).
 

Research Areas for TRIB1 Antibody (NBP1-55386)

Find related products by research area.

Blogs on TRIB1

There are no specific blogs for TRIB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIB1
Entrez
Uniprot