AMICA/JAML Antibody

Western Blot: AMICA/JAML Antibody [NBP2-14286] - Analysis in human lung tissue.

Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Staining of human rectum shows moderate positivity in stroma cells.

Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Immunohistochemical analysis of paraffin embedded mouse kidney tissue using control rabbit IgG (left) and anti-AMICA/JAML antibody (right). Image from verified customer review.

Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Staining of human lymph node shows moderate positivity in lymphoida cells.

Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Staining of human lung shows moderate positivity in macrophages.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

AMICA/JAML Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAML
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. AMICA/JAML antibody validated for IHC-P from a verified customer review.
• Control Peptide:

  AMICA/JAML Protein (NBP2-14286PEP)

Reactivity Notes

Reported reactivity in Mouse kidney tissue from a verified customer review.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for AMICA/JAML Antibody

• adhesion molecule, interacts with CXADR antigen 1
• AMICA
• AMICA1
• CREA7-1
• Gm638
• JAML

Background

JAML may function in transmigration of leukocytes through epithelial and endothelial tissues. Expressed at the plasma membrane of polymorphonuclear leukocytes, it mediates adhesiveinteractions with CXADR, a protein of the junctional complex of epithelial cell

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AMICA/JAML Antibody (NBP2-14286)(2)

Publications using NBP2-14286

• Fang Y, Yang J, Zu G et al. Junctional Adhesion Molecule-Like Protein Promotes Tumor Progression and Metastasis via p38 Signaling Pathway in Gastric Cancer Frontiers in oncology 2021-03-11 [PMID: 33777731] (IHC-P, Human)
• Fu Y, Sun Y, Wang M et al. Elevation of JAML Promotes Diabetic Kidney Disease by Modulating Podocyte Lipid Metabolism Cell Metab 2020-12-01 [PMID: 33186558]

Review for AMICA/JAML Antibody (NBP2-14286) (1)

Average Rating: 5

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Lisa Ikariyama IHC-P Mouse 12/15/2016

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: kidney
• Species: Mouse
• Lot: R45096

Comments

• Comments: Antibody Storage Conditions:Store at 4C short term. Aliquot and store at -20℃ long term. Avoid freeze-thaw cycles.
  
  Test Sample Information:
  Species & Treatments:mouse
  Tissue: kidney
  Fixative Composition: 4% Paraformaldehyde solution
  Fixation Time & Temperature: 24h，4℃
  Tissue Processing: paraffin embedding
  
  Antigen Retrieval Details (for IHC-P):
  Method & Buffer Used: Citric Acid Antigen Retrieval Buffer
  Time & Temperature: >95℃ 20min
  
  Blocking Procedure:
  Blocking Solution: 5% Goat serum，0.1%BSA
  Time & Temperature: 1h，room temperature
  
  Endogenous Peroxidase Blocking (For IHC-P only)
  H2O2 cocktail composition: 3% H2O2
  Blocking Time: 10min
  
  Primary Antibody
  Dilution: 1:100
  Diluent Buffer: 0.1%BSA（PBS）
  Time & Temperature: overnight，4℃
  
  Washing Conditions:
  Wash Buffer Composition: PBS
  Method (Immersion, Rinsing etc.): Immersion
  Times/Washing: 5min
  Repetitions: 3
  
  Secondary Antibody
  Manufacturer and Catalog #: Zhongshan golden bridge ZB-2301
  Secondary description:goat anti-rabbit
  Dilution: 1:100
  Diluent Buffer: PBS
  Incubation Time & Temperature: 1h，room temperature
  
  Post-Secondary Washing: 5min X 3 times
  
  Detection Method:
  Detection: Zhongshan golden bridge SP-9000
  Procedure: according to the instruction book
  DAB-Incubation Time (if applicable):3min
  
  Controls:
  Negative Control: Control rabbit IgG

Bioinformatics

• Gene Symbol: JAML
• Entrez:
  • 120425(Human)