AMICA/JAML Antibody

Images

 
Western Blot: JAML Antibody [NBP2-14286] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: AMICA/JAML Antibody [NBP2-14286] - Immunohistochemical analysis of paraffin embedded mouse kidney tissue using control rabbit IgG (left) and anti-AMICA/JAML antibody (right). Image from ...read more
Immunohistochemistry-Paraffin: JAML Antibody [NBP2-14286] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMICA/JAML Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVRE VIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMICA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AMICA/JAML Protein (NBP2-14286PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-14286 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AMICA/JAML Antibody

  • adhesion molecule, interacts with CXADR antigen 1
  • AMICA
  • AMICA1
  • CREA7-1
  • Gm638
  • JAML

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1103
Species: Hu
Applications: WB, IHC, ICC
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF1213
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1103
Species: Hu
Applications: WB, IHC, ICC
AF1074
Species: Hu, Mu
Applications: WB, Simple Western, Neut
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NLS261
Species: Hu
Applications: WB (-), IHC-P, ICC

Publications for AMICA/JAML Antibody (NBP2-14286) (0)

There are no publications for AMICA/JAML Antibody (NBP2-14286).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for AMICA/JAML Antibody (NBP2-14286) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.
We have 1 review tested in 1 application: IHC-P.

Reviews using NBP2-14286:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin AMICA/JAML NBP2-14286
Enlarge
reviewed by:
Anonymous
IHC-P Mouse 12/15/2016
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample Testedkidney
SpeciesMouse
LotR45096

Comments

CommentsAntibody Storage Conditions:Store at 4C short term. Aliquot and store at -20℃ long term. Avoid freeze-thaw cycles.

Test Sample Information:
Species & Treatments:mouse
Tissue: kidney
Fixative Composition: 4% Paraformaldehyde solution
Fixation Time & Temperature: 24h,4℃
Tissue Processing: paraffin embedding

Antigen Retrieval Details (for IHC-P):
Method & Buffer Used: Citric Acid Antigen Retrieval Buffer
Time & Temperature: >95℃ 20min

Blocking Procedure:
Blocking Solution: 5% Goat serum,0.1%BSA
Time & Temperature: 1h,room temperature

Endogenous Peroxidase Blocking (For IHC-P only)
H2O2 cocktail composition: 3% H2O2
Blocking Time: 10min

Primary Antibody
Dilution: 1:100
Diluent Buffer: 0.1%BSA(PBS)
Time & Temperature: overnight,4℃

Washing Conditions:
Wash Buffer Composition: PBS
Method (Immersion, Rinsing etc.): Immersion
Times/Washing: 5min
Repetitions: 3

Secondary Antibody
Manufacturer and Catalog #: Zhongshan golden bridge ZB-2301
Secondary description:goat anti-rabbit
Dilution: 1:100
Diluent Buffer: PBS
Incubation Time & Temperature: 1h,room temperature

Post-Secondary Washing: 5min X 3 times

Detection Method:
Detection: Zhongshan golden bridge SP-9000
Procedure: according to the instruction book
DAB-Incubation Time (if applicable):3min

Controls:
Negative Control: Control rabbit IgG

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMICA/JAML Antibody (NBP2-14286) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AMICA/JAML Products

Bioinformatics Tool for AMICA/JAML Antibody (NBP2-14286)

Discover related pathways, diseases and genes to AMICA/JAML Antibody (NBP2-14286). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMICA/JAML Antibody (NBP2-14286)

Discover more about diseases related to AMICA/JAML Antibody (NBP2-14286).
 

Pathways for AMICA/JAML Antibody (NBP2-14286)

View related products by pathway.

PTMs for AMICA/JAML Antibody (NBP2-14286)

Learn more about PTMs related to AMICA/JAML Antibody (NBP2-14286).

Blogs on AMICA/JAML

There are no specific blogs for AMICA/JAML, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
12/15/2016
Application: IHC-P
Species: Mouse

Bioinformatics

Gene Symbol AMICA1
Entrez