Recombinant Human Claudin-7 Protein

Images

 
Recombinant Human Claudin-7 Protein [H00001366-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Claudin-7 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-211 of Human CLDN7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CLDN7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
48.8 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00001366-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-7 Protein

  • CEPTRL2
  • claudin 7
  • claudin-1
  • Claudin7
  • Claudin-7
  • CLDN7
  • CLDN-7
  • clostridium perfringens enterotoxin receptor-like 2
  • CPETRL2

Background

Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85047
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KO
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-58264
Species: Hu
Applications: WB, ICC/IF
NBP2-02259
Species: Hu, Po
Applications: Flow, ICC/IF, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-65805
Species: Hu, Gt, Pm, Sh
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-59157
Species: Hu, Rt, Po, Bv, Ca, Eq, Rb
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC, IHC-Fr, IF
MAB3656
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49230
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-104
Species: Hu, Mu, Rt, Po, ChHa, SyHa, Ha, Md, Pm, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00001366-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Claudin-7 Recombinant Protein (H00001366-P01)(1)

Reviews for Claudin-7 Recombinant Protein (H00001366-P01) (0)

There are no reviews for Claudin-7 Recombinant Protein (H00001366-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Claudin-7 Recombinant Protein (H00001366-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Claudin-7 Products

Bioinformatics Tool for Claudin-7 Recombinant Protein (H00001366-P01)

Discover related pathways, diseases and genes to Claudin-7 Recombinant Protein (H00001366-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Claudin-7 Recombinant Protein (H00001366-P01)

Discover more about diseases related to Claudin-7 Recombinant Protein (H00001366-P01).
 

Pathways for Claudin-7 Recombinant Protein (H00001366-P01)

View related products by pathway.

PTMs for Claudin-7 Recombinant Protein (H00001366-P01)

Learn more about PTMs related to Claudin-7 Recombinant Protein (H00001366-P01).
 

Research Areas for Claudin-7 Recombinant Protein (H00001366-P01)

Find related products by research area.

Blogs on Claudin-7

There are no specific blogs for Claudin-7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SR-BI Antibody
NB400-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Claudin-7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CLDN7