Recombinant Human Claudin-7 GST (N-Term) Protein

Recombinant Human Claudin-7 Protein [H00001366-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP, Enzyme Activity

Recombinant Human Claudin-7 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-211 of Human CLDN7
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CLDN7
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Enzyme Activity
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 48.8 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Claudin-7 GST (N-Term) Protein

• CEPTRL2
• claudin 7
• claudin-1
• Claudin7
• Claudin-7
• CLDN7
• CLDN-7
• clostridium perfringens enterotoxin receptor-like 2
• CPETRL2

Background

Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Claudin-7 Recombinant Protein (H00001366-P01)(1)

Publication using H00001366-P01

• Vilen ST, Suojanen J, Salas F et al. Trypsin-2 Enhances Carcinoma Invasion by Processing Tight Junctions and Activating ProMT1-MMP. Cancer Invest. 2012-03-01 [PMID: 22909050]

Bioinformatics

• Gene Symbol: CLDN7