alpha Tubulin 4a Antibody

Western Blot: alpha Tubulin 4a Antibody [NBP1-53162] - Human Small Intestine, concentration 0.2-1 ug/ml.

Product Discontinued

alpha Tubulin 4a Antibody Summary

• Immunogen: Synthetic peptide directed towards the middle region of human alpha Tubulin 4A (NP_005991). Peptide sequence GGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TUBA4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against alpha Tubulin 4A and was validated on Western blot.
• Theoretical MW: 50 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for alpha Tubulin 4a Antibody

• alpha 1 (testis specific)
• alpha Tubulin 4a
• Alpha-tubulin 1
• FLJ30169
• H2-ALPHA
• Testis-specific alpha-tubulin
• TUBA1
• TUBA4A
• Tubulin alpha-1 chain
• tubulin alpha-4A chain
• Tubulin H2-alpha
• tubulin, alpha 1
• tubulin, alpha 4a

Background

Microtubules are involved in a wide variety of cellular activities ranging from mitosis and transport events to cell movement and the maintainance of cell shape. Tubulin itself is a globular protein which consists of two polypeptides (alpha and beta tubulin). Alpha and beta tubulin dimers are assembled to 13 protofilaments that form a microtubule of 22 nm diameter. Tyrosine ligase ads a C-terminal tyrosin to monomeric alpha tubulin. Assembled microtubules can again be detyrosinated by a cytoskeleton associated carboxypeptidase. Detyrosinated alpha tubulin is referred to as Glu-tubulin. Another post-translational modification of detyrosinated alpha tubulin is C-terminal polyglutamylation which is characteristic for microtubules in neuronal cells and the mitotic spindle. Alpha tubulin is not suitable as loading control in adipose tissue as expression of tubulin in adipose tissue is very low ( Spiegelman and Farmer, Cell, 1982, 29(1):53-60) in cells undergoing adipose differentiation actin synthesis decreases by 90%. Excellent as a protein loading control antibody.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for alpha Tubulin 4a Antibody (NBP1-53162)(1)

Publication using NBP1-53162

• Maraldi T, Beretti F, Anselmi L et al. Influence of selenium on the emergence of neuro tubule defects in a neuron-like cell line and its implications for amyotrophic lateral sclerosis NeuroToxicology 2019-10-01 [PMID: 31585128] (WB, Human)

Bioinformatics

• Gene Symbol: TUBA4A
• Entrez:
  • 7277(Human)
• Uniprot:
  • P68366(Human)