NAG Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NAG Antibody [NBP1-92164] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: NAG Antibody [NBP1-92164] - Staining of human heart muscle shows cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NAG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPERGYGDKTEATTKLHDMVDQLEQILSVS
Specificity
Specificity of human NAG antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NBAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NAG Protein (NBP1-92164PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NAG Antibody

  • DKFZp586G1219
  • EC 1.1.1.94
  • EC 1.2.1.59
  • FLJ40407
  • NAG/BC035112 fusion
  • NAG/FAM49A fusion
  • NAGneuroblastoma-amplified protein
  • neuroblastoma amplified sequence
  • Neuroblastoma-amplified gene protein
  • neuroblastoma-amplified sequence

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
AF2009
Species: Hu
Applications: WB, IHC
NBP1-32244
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF1239
Species: Mu
Applications: WB, IHC, IP
NBP2-54724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33855
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-80851
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88000
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1857
Species: Mu
Applications: WB, Simple Western, IP
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92164
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NAG Antibody (NBP1-92164) (0)

There are no publications for NAG Antibody (NBP1-92164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NAG Antibody (NBP1-92164) (0)

There are no reviews for NAG Antibody (NBP1-92164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NAG Antibody (NBP1-92164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NAG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NBAS