HEXDC Antibody

Images

 
Western Blot: HEXDC Antibody [NBP1-83574] - Analysis in control (vector only transfected HEK293T lysate) and HEXDC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: HEXDC Antibody [NBP1-83574] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry-Paraffin: HEXDC Antibody [NBP1-83574] - Staining of human cerebellum shows strong cytoplasmic positivity in granular layer cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HEXDC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEXDC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HEXDC Protein (NBP1-83574PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEXDC Antibody

  • Beta-hexosaminidase D
  • beta-N-acetylhexosaminidase
  • EC 3.2.1.52
  • FLJ23825
  • hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing
  • hexosaminidase D
  • Hexosaminidase domain-containing protein
  • N-acetyl-beta-galactosaminidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
H00003087-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-87511
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84318
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF1029
Species: Mu
Applications: WB, IHC, IP, ICC
NBP1-74127
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-31555
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49211
Species: Hu
Applications: IHC, IHC-P
NBP3-04803
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-922
Species: Ch, V-Vi
Applications: WB, ELISA, IHC, IHC-P, IP, Single-Cell Western
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HEXDC Antibody (NBP1-83574) (0)

There are no publications for HEXDC Antibody (NBP1-83574).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEXDC Antibody (NBP1-83574) (0)

There are no reviews for HEXDC Antibody (NBP1-83574). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HEXDC Antibody (NBP1-83574) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HEXDC Products

Bioinformatics Tool for HEXDC Antibody (NBP1-83574)

Discover related pathways, diseases and genes to HEXDC Antibody (NBP1-83574). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for HEXDC Antibody (NBP1-83574)

View related products by pathway.

Research Areas for HEXDC Antibody (NBP1-83574)

Find related products by research area.

Blogs on HEXDC

There are no specific blogs for HEXDC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEXDC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEXDC