alpha 2-Macroglobulin Antibody (2B5) - Azide and BSA Free

Proximity Ligation Assay: alpha 2-Macroglobulin Antibody (2B5) [H00000002-M03] - Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 and anti-A2M mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

ELISA: alpha 2-Macroglobulin Antibody (2B5) [H00000002-M03] - Detection limit for recombinant GST tagged A2M is 3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, Func
• Clone: 2B5
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

alpha 2-Macroglobulin Antibody (2B5) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: A2M (NP_000005.2, 641 a.a. ~ 730 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
• Specificity: A2M - alpha-2-macroglobulin (2B5)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: A2M
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Proximity Ligation Assay
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha 2-Macroglobulin Antibody (2B5) - Azide and BSA Free

• A2M
• alpha 2Macroglobulin
• alpha 2-Macroglobulin
• alpha-2-M
• alpha-2-macroglobulin
• C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
• CPAMD5
• CPAMD5DKFZp779B086
• FWP007
• S863-7

Background

Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: A2M
• Entrez:
  • 2(Human)
• Uniprot:
  • NP_000005(Human)