alpha 2-Macroglobulin Antibody (2B5)

Images

 
Proximity Ligation Assay: alpha 2-Macroglobulin Antibody (2B5) [H00000002-M03] - Analysis of protein-protein interactions between IL1B and A2M. HeLa cells were stained with anti-IL1B rabbit purified polyclonal 1:1200 ...read more
ELISA: alpha 2-Macroglobulin Antibody (2B5) [H00000002-M03] - Detection limit for recombinant GST tagged A2M is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
2B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

alpha 2-Macroglobulin Antibody (2B5) Summary

Immunogen
A2M (NP_000005.2, 641 a.a. - 730 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DCINRHNVYINGITYTPVSSTNEKDMYSFLEDMGLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHVEEPHTET
Specificity
A2M - alpha-2-macroglobulin (2B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
A2M
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for alpha 2-Macroglobulin Antibody (2B5)

  • A2M
  • alpha 2Macroglobulin
  • alpha 2-Macroglobulin
  • alpha-2-M
  • alpha-2-macroglobulin
  • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5
  • CPAMD5
  • CPAMD5DKFZp779B086
  • FWP007
  • S863-7

Background

Alpha-2-macroglobulin is a protease inhibitor and cytokine transporter. It inhibits many proteases, including trypsin, thrombin and collagenase. A2M is implicated in Alzheimer disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-12553
Species: Hu
AF1267
Species: Hu
Applications: WB, IP, Neut
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF4409
Species: Mu
Applications: WB
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC

Publications for alpha 2-Macroglobulin Antibody (H00000002-M03) (0)

There are no publications for alpha 2-Macroglobulin Antibody (H00000002-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha 2-Macroglobulin Antibody (H00000002-M03) (0)

There are no reviews for alpha 2-Macroglobulin Antibody (H00000002-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for alpha 2-Macroglobulin Antibody (H00000002-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional alpha 2-Macroglobulin Products

Bioinformatics Tool for alpha 2-Macroglobulin Antibody (H00000002-M03)

Discover related pathways, diseases and genes to alpha 2-Macroglobulin Antibody (H00000002-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for alpha 2-Macroglobulin Antibody (H00000002-M03)

Discover more about diseases related to alpha 2-Macroglobulin Antibody (H00000002-M03).
 

Pathways for alpha 2-Macroglobulin Antibody (H00000002-M03)

View related products by pathway.

PTMs for alpha 2-Macroglobulin Antibody (H00000002-M03)

Learn more about PTMs related to alpha 2-Macroglobulin Antibody (H00000002-M03).
 

Research Areas for alpha 2-Macroglobulin Antibody (H00000002-M03)

Find related products by research area.

Blogs on alpha 2-Macroglobulin

There are no specific blogs for alpha 2-Macroglobulin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our alpha 2-Macroglobulin Antibody (2B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol A2M
Entrez
Uniprot