Aldolase A Antibody (2E6) - Azide and BSA Free

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in NIH/3T3 (Cat # L018V1).

Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in HepG2 (Cat # L019V1).

• Reactivity: Hu, Mu
• Applications: WB, ELISA
• Clone: 2E6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Aldolase A Antibody (2E6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ALDOA (AAH10660.1, 21 a.a. ~ 95 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP
• Specificity: ALDOA - aldolase A, fructose-bisphosphate (2E6)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ALDOA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldolase A Antibody (2E6) - Azide and BSA Free

• ALDA
• aldolase A, fructose-bisphosphate
• EC 4.1.2.13
• fructose-1,6-bisphosphate triosephosphate-lyase
• fructose-bisphosphate aldolase A
• GSD12
• Lung cancer antigen NY-LU-1
• MGC10942
• MGC17716
• MGC17767
• Muscle-type aldolase

Background

This gene product, Aldolase A (fructose-bisphosphate aldolase) is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants which encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Aldolase A Antibody (H00000226-M03)(1)

Publication using H00000226-M03

• Halbert D, Domenyuk V, Spetzler D et al. Aptamers and uses thereof United States Patent Application US 9958448 B2 2018-01-01

Bioinformatics

• Gene Symbol: ALDOA
• Entrez:
  • 226(Human)
• Uniprot:
  • AAH10660(Human)