Aldolase A Antibody (2E6.)

Images

 
Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in HepG2 (Cat # L019V1).
Western Blot: Aldolase A Antibody (2E6) [H00000226-M03] - Analysis of ALDOA expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
2E6.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Aldolase A Antibody (2E6.) Summary

Immunogen
ALDOA (AAH10660.1, 21 a.a. - 95 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFP
Specificity
ALDOA - aldolase A, fructose-bisphosphate (2E6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALDOA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Aldolase A Antibody (2E6.)

  • ALDA
  • aldolase A, fructose-bisphosphate
  • EC 4.1.2.13
  • fructose-1,6-bisphosphate triosephosphate-lyase
  • fructose-bisphosphate aldolase A
  • GSD12
  • Lung cancer antigen NY-LU-1
  • MGC10942
  • MGC17716
  • MGC17767
  • Muscle-type aldolase

Background

This gene product, Aldolase A (fructose-bisphosphate aldolase) is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Aldolase A is found in the developing embryo and is produced in even greater amounts in adult muscle. Aldolase A expression is repressed in adult liver, kidney and intestine and similar to aldolase C levels in brain and other nervous tissue. Aldolase A deficiency has been associated with myopathy and hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants which encode the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
H00055821-D01P
Species: Hu, Mu
Applications: WB, ELISA
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP1-48336
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32433
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-48308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
AF2180
Species: Hu
Applications: WB, Simple Western, IP
H00006690-M01
Species: Hu
Applications: WB, ELISA, IHC-P, IP
H00000226-M03
Species: Hu, Mu
Applications: WB, ELISA

Publications for Aldolase A Antibody (H00000226-M03) (0)

There are no publications for Aldolase A Antibody (H00000226-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aldolase A Antibody (H00000226-M03) (0)

There are no reviews for Aldolase A Antibody (H00000226-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Aldolase A Antibody (H00000226-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Aldolase A Products

Bioinformatics Tool for Aldolase A Antibody (H00000226-M03)

Discover related pathways, diseases and genes to Aldolase A Antibody (H00000226-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aldolase A Antibody (H00000226-M03)

Discover more about diseases related to Aldolase A Antibody (H00000226-M03).
 

Pathways for Aldolase A Antibody (H00000226-M03)

View related products by pathway.

PTMs for Aldolase A Antibody (H00000226-M03)

Learn more about PTMs related to Aldolase A Antibody (H00000226-M03).
 

Research Areas for Aldolase A Antibody (H00000226-M03)

Find related products by research area.

Blogs on Aldolase A

There are no specific blogs for Aldolase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Aldolase A Antibody (2E6.) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDOA
Entrez
Uniprot