AHR Antibody

Images

 
Western Blot: Aryl hydrocarbon Receptor Antibody [NBP1-89975] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-48
Immunohistochemistry-Paraffin: Aryl hydrocarbon Receptor Antibody [NBP1-89975] - Staining of human cerebral cortex shows strong nuclear positivity in a subset of glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AHR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHHPSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AHR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AHR Protein (NBP1-89975PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AHR Antibody

  • Ah receptor
  • AHR
  • AH-receptor
  • aryl hydrocarbon receptor
  • BHLHE76
  • bHLHe76aromatic hydrocarbon receptor
  • Class E basic helix-loop-helix protein 76

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-124
Species: Hu, Mu, Rt, Bv, Ft, Pm, Sh
Applications: WB, ChIP, GS, ICC/IF, IHC, IHC-P, IP
NBP2-24722
Species: Hu
Applications: WB, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-922
Species: Ch, Vi
Applications: WB, ELISA, IHC, IHC-P, IP
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00057491-R01
Species: Hu
NBP1-59786
Species: Hu
Applications: WB
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA

Publications for AHR Antibody (NBP1-89975) (0)

There are no publications for AHR Antibody (NBP1-89975).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AHR Antibody (NBP1-89975) (0)

There are no reviews for AHR Antibody (NBP1-89975). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AHR Antibody (NBP1-89975) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AHR Products

Bioinformatics Tool for AHR Antibody (NBP1-89975)

Discover related pathways, diseases and genes to AHR Antibody (NBP1-89975). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AHR Antibody (NBP1-89975)

Discover more about diseases related to AHR Antibody (NBP1-89975).
 

Pathways for AHR Antibody (NBP1-89975)

View related products by pathway.

PTMs for AHR Antibody (NBP1-89975)

Learn more about PTMs related to AHR Antibody (NBP1-89975).
 

Research Areas for AHR Antibody (NBP1-89975)

Find related products by research area.

Blogs on AHR.

AHR - A transcription factor regulating immunity and tumorigenesis
The aryl hydrocarbon receptor (AHR) is a ligand activated transcription factor that controls the expression of a diverse set of genes. In the absence of ligand, AHR is retained in the cytoplasm. Upon ligand binding AHR translocates to the nucleus w...  Read full blog post.

Aryl Hydrocarbon Signaling: AIP, AhR, ARNT, BMAL1 and more...
AH receptor-interacting protein (AIP) is a 37 kD immunophilin-like factor found in a variety of tissues with expression levels ranging from high (spleen, thymus, pituitary heart, placenta and skeletal muscle) to low (liver, kidney and lung). It mediat...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AHR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AHR
Entrez