SLC45A2 Antibody


Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC45A2 Antibody [NBP1-59786] - Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate.
Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: SLC45A2 Antibody [NBP1-59786] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

SLC45A2 Antibody Summary

Synthetic peptides corresponding to SLC45A2(solute carrier family 45, member 2) The peptide sequence was selected from the middle region of SLC45A2. Peptide sequence IGWTAFLSNMLFFTDFMGQIVYRGDPYSAHNSTEFLIYERGVEVGCWGFC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC45A2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC45A2 Antibody

  • AIM-1
  • AIM11A1
  • MATPmembrane associated transporter
  • Melanoma antigen AIM1
  • membrane-associated transporter protein
  • Protein AIM-1
  • SHEP5
  • Solute carrier family 45 member 2
  • solute carrier family 45, member 2
  • underwhite


SLC45A2 is a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4.The protein encoded by this gene encodes a melanocyte differentiation antigen that is expressed in a high percentage of melanoma cell lines. A similar sequence gene in medaka, 'B,' encodes a transporter that mediates melanin synthesis. Mutations in this gene are a cause of oculocutaneous albinism type 4. Alternative splicing results in multiple transcript variants encoding different isoforms.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC45A2 Antibody (NBP1-59786) (0)

There are no publications for SLC45A2 Antibody (NBP1-59786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC45A2 Antibody (NBP1-59786) (0)

There are no reviews for SLC45A2 Antibody (NBP1-59786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC45A2 Antibody (NBP1-59786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SLC45A2 Antibody (NBP1-59786)

Discover related pathways, diseases and genes to SLC45A2 Antibody (NBP1-59786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC45A2 Antibody (NBP1-59786)

Discover more about diseases related to SLC45A2 Antibody (NBP1-59786).

Pathways for SLC45A2 Antibody (NBP1-59786)

View related products by pathway.

PTMs for SLC45A2 Antibody (NBP1-59786)

Learn more about PTMs related to SLC45A2 Antibody (NBP1-59786).

Research Areas for SLC45A2 Antibody (NBP1-59786)

Find related products by research area.

Blogs on SLC45A2

There are no specific blogs for SLC45A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC45A2 Antibody and receive a gift card or discount.


Gene Symbol SLC45A2