ADK Antibody


Orthogonal Strategies: Western Blot: ADK Antibody [NBP1-90197] - Analysis in human cell lines PC-3 and A-549 using anti-ADK antibody. Corresponding ADK RNA-seq data are presented for the same cell lines. Loading more
Immunocytochemistry/ Immunofluorescence: ADK Antibody [NBP1-90197] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ADK Antibody [NBP1-90197] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.
Western Blot: ADK Antibody [NBP1-90197] - Analysis in human cell line A-431.
Western Blot: ADK Antibody [NBP1-90197] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

ADK Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
Specificity of human, mouse, rat ADK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
ADK Lysate (NBP2-65268)
Control Peptide
ADK Protein (NBP1-90197PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ADK Antibody

  • adenosine kinase
  • ADK
  • AK
  • AKAdenosine 5'-phosphotransferase
  • EC 2.7.1
  • EC


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADK Antibody (NBP1-90197) (0)

There are no publications for ADK Antibody (NBP1-90197).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADK Antibody (NBP1-90197) (0)

There are no reviews for ADK Antibody (NBP1-90197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADK Antibody (NBP1-90197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional ADK Products

Bioinformatics Tool for ADK Antibody (NBP1-90197)

Discover related pathways, diseases and genes to ADK Antibody (NBP1-90197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADK Antibody (NBP1-90197)

Discover more about diseases related to ADK Antibody (NBP1-90197).

Pathways for ADK Antibody (NBP1-90197)

View related products by pathway.

PTMs for ADK Antibody (NBP1-90197)

Learn more about PTMs related to ADK Antibody (NBP1-90197).

Research Areas for ADK Antibody (NBP1-90197)

Find related products by research area.

Blogs on ADK

There are no specific blogs for ADK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADK Antibody and receive a gift card or discount.


Gene Symbol ADK