ADK Antibody

Images

 
Western Blot: ADK Antibody [NBP1-90197] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: ADK Antibody [NBP1-90197] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ADK Antibody [NBP1-90197] - Staining of human lymph node shows strong nuclear positivity in cells outside the reaction centra.
Western Blot: ADK Antibody [NBP1-90197] - Analysis in human cell line A-431.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADK Protein (NBP1-90197PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADK Antibody

  • adenosine kinase
  • ADK
  • AK
  • AKAdenosine 5'-phosphotransferase
  • EC 2.7.1
  • EC 2.7.1.20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88529
Species: Hu
Applications: WB, IHC, IHC-P
AF6486
Species: Hu
Applications: WB, Simple Western
AF6466
Species: Hu
Applications: WB
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87401
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43639
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-20310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NBP1-90197
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADK Antibody (NBP1-90197) (0)

There are no publications for ADK Antibody (NBP1-90197).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADK Antibody (NBP1-90197) (0)

There are no reviews for ADK Antibody (NBP1-90197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ADK Antibody (NBP1-90197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADK Products

Bioinformatics Tool for ADK Antibody (NBP1-90197)

Discover related pathways, diseases and genes to ADK Antibody (NBP1-90197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADK Antibody (NBP1-90197)

Discover more about diseases related to ADK Antibody (NBP1-90197).
 

Pathways for ADK Antibody (NBP1-90197)

View related products by pathway.

PTMs for ADK Antibody (NBP1-90197)

Learn more about PTMs related to ADK Antibody (NBP1-90197).
 

Research Areas for ADK Antibody (NBP1-90197)

Find related products by research area.

Blogs on ADK

There are no specific blogs for ADK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADK
Entrez