Adenosylhomocysteinase/AHCY Antibody

Images

 
Independent Antibodies: Western Blot: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Analysis using Anti-AHCY antibody NBP2-48817 (A) shows similar pattern to independent antibody NBP2-48731 (B).
Immunocytochemistry/ Immunofluorescence: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Staining of human cell line CACO-2 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Adenosylhomocysteinase/AHCY Antibody [NBP2-48817] - Staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

Adenosylhomocysteinase/AHCY Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHY
Specificity
Specificity of human Adenosylhomocysteinase/AHCY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AHCY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Adenosylhomocysteinase/AHCY Recombinant Protein Antigen (NBP2-48817PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenosylhomocysteinase/AHCY Antibody

  • Adenosylhomocysteinase
  • AdoHcyase
  • AHCY
  • EC 3.3.1.1
  • S-adenosylhomocysteine hydrolase
  • S-adenosyl-L-homocysteine hydrolase
  • SAHH
  • SAHHadoHcyase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
H00006296-D01P
Species: Hu, Mu
Applications: WB
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88530
Species: Hu
Applications: IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000875-M01
Species: Hu, Mu, Rt, Po, Ba
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RNAi
AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP1-85740
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB6526
Species: Hu
Applications: WB, IP
NBP1-82541
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83093
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-791
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NB110-83976
Species: Hu, Mu, Pm
Applications: WB
NBP2-48817
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817) (0)

There are no publications for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817) (0)

There are no reviews for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Adenosylhomocysteinase/AHCY Products

Bioinformatics Tool for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817)

Discover related pathways, diseases and genes to Adenosylhomocysteinase/AHCY Antibody (NBP2-48817). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817)

Discover more about diseases related to Adenosylhomocysteinase/AHCY Antibody (NBP2-48817).
 

Pathways for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817)

View related products by pathway.

PTMs for Adenosylhomocysteinase/AHCY Antibody (NBP2-48817)

Learn more about PTMs related to Adenosylhomocysteinase/AHCY Antibody (NBP2-48817).

Blogs on Adenosylhomocysteinase/AHCY

There are no specific blogs for Adenosylhomocysteinase/AHCY, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenosylhomocysteinase/AHCY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AHCY