Adenylosuccinate Lyase Antibody

Images

 
Western Blot: Adenylosuccinate Lyase Antibody [NBP1-87406] - Analysis in human cell line HL-60.
Immunocytochemistry/ Immunofluorescence: Adenylosuccinate Lyase Antibody [NBP1-87406] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Adenylosuccinate Lyase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADSL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Adenylosuccinate Lyase Protein (NBP1-87406PEP)
Publications
Read Publications using NBP1-87406.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Adenylosuccinate Lyase Antibody

  • adenylosuccinase
  • adenylosuccinate lyase
  • AMPS
  • ASase
  • ASL
  • EC 4.3.2
  • EC 4.3.2.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-00153
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-90360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89192
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87408
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-42388
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89519
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87406
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Adenylosuccinate Lyase Antibody (NBP1-87406)(2)

Reviews for Adenylosuccinate Lyase Antibody (NBP1-87406) (0)

There are no reviews for Adenylosuccinate Lyase Antibody (NBP1-87406). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Adenylosuccinate Lyase Antibody (NBP1-87406) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Adenylosuccinate Lyase Products

Bioinformatics Tool for Adenylosuccinate Lyase Antibody (NBP1-87406)

Discover related pathways, diseases and genes to Adenylosuccinate Lyase Antibody (NBP1-87406). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Adenylosuccinate Lyase Antibody (NBP1-87406)

Discover more about diseases related to Adenylosuccinate Lyase Antibody (NBP1-87406).
 

Pathways for Adenylosuccinate Lyase Antibody (NBP1-87406)

View related products by pathway.

PTMs for Adenylosuccinate Lyase Antibody (NBP1-87406)

Learn more about PTMs related to Adenylosuccinate Lyase Antibody (NBP1-87406).
 

Research Areas for Adenylosuccinate Lyase Antibody (NBP1-87406)

Find related products by research area.

Blogs on Adenylosuccinate Lyase

There are no specific blogs for Adenylosuccinate Lyase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Adenylosuccinate Lyase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADSL
Entrez
Uniprot