Adenylosuccinate Lyase Antibody - BSA Free

Western Blot: Adenylosuccinate Lyase Antibody [NBP1-87406] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADSL antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Western Blot: Adenylosuccinate Lyase Antibody [NBP1-87406] - Analysis in human cell line HL-60.

Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human cerebral cortex shows no positivity in neuronal cells.

Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: Adenylosuccinate Lyase Antibody [NBP1-87406] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Adenylosuccinate Lyase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Adenylosuccinate Lyase Antibody - BSA Free (NBP1-87406) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Adenylosuccinate Lyase Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RRICLAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDCHEKIRVLSQQAASVVKQEGGDNDLIERIQVDAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVYPLLKPYESVMKVKA
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADSL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  Adenylosuccinate Lyase Protein (NBP1-87406PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Adenylosuccinate Lyase Antibody - BSA Free

• adenylosuccinase
• adenylosuccinate lyase
• AMPS
• ASase
• ASL
• EC 4.3.2
• EC 4.3.2.2

Background

Adenylsuccinate lyase is involved in both de novo synthesis of purines and formation of adenosine monophosphate from inosine monophosphate. It catalyzes two reactions in AMP biosynthesis: the removal of a fumarate from succinylaminoimidazole carboxamide (SAICA) ribotide to give aminoimidazole carboxamide ribotide (AICA) and removal of fumarate from adenylosuccinate to give AMP. Adenylosuccinase deficiency results in succinylpurinemic autism, psychomotor retardation, and , in some cases, growth retardation associated with muscle wasting and epilepsy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Adenylosuccinate Lyase Antibody (NBP1-87406)(2)

Publications using NBP1-87406

• Stadler C, Hjelmare M, Neumann B et al. Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy. J Proteomics 2012-04-03 [PMID: 22361696]
• Baresova V, Skopova V, Sikora J et al. Mutations of ATIC and ADSL affect purinosome assembly in cultured skin fibroblasts from patients with AICA-ribosiduria and ADSL deficiency. Hum Mol Genet 2012-04-01 [PMID: 22180458]

Bioinformatics

• Gene Symbol: ADSL
• Entrez:
  • 158(Human)
• Uniprot:
  • P30566(Human)