ACSL3 Antibody - BSA Free

Immunohistochemistry: ACSL3 Antibody [NBP3-35183] - Immunohistochemistry analysis of paraffin-embedded Human mammary cancer using ACSL3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: ACSL3 Antibody [NBP3-35183] - Western blot analysis of various lysates using ACSL3 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

Immunohistochemistry: ACSL3 Antibody [NBP3-35183] - Immunohistochemistry analysis of paraffin-embedded Human stomach using ACSL3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: ACSL3 Antibody [NBP3-35183] - Immunohistochemistry analysis of paraffin-embedded Rat heart using ACSL3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: ACSL3 Antibody [NBP3-35183] - Immunohistochemistry analysis of paraffin-embedded Mouse heart using ACSL3 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACSL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACSL3 Antibody - BSA Free (NBP3-35183) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 621-720 of human ACSL3 (NP_004448.2).
  
  Sequence:
  VIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERMYGRK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 80 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for ACSL3 Antibody - BSA Free

• ACS3EC 6.2.1.3
• acyl-CoA synthetase long-chain family member 3
• FACL3lignoceroyl-CoA synthase
• fatty-acid-Coenzyme A ligase, long-chain 3
• LACS 3
• LACS3
• Long-chain acyl-CoA synthetase 3
• long-chain-fatty-acid--CoA ligase 3
• PRO2194

Background

Long-chain-fatty-acid--CoA ligase 3, or ACSL3, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the biosynthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS3 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL3 mediates hepatic lipogenesis By similarity and has a mainly anabolic role in energy metabolism.

This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACSL3