ACSL3 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ACSL3 Antibody [NBP2-58817] - Staining of human cell line SK-MEL-30 shows localization to nucleoli & lipid droplets.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ACSL3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ACSL3 Antibody - BSA Free (NBP2-58817) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACSL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ACSL3 Recombinant Protein Antigen (NBP2-58817PEP)

Reactivity Notes

Mouse, Rat (89%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ACSL3 Antibody - BSA Free

• ACS3EC 6.2.1.3
• acyl-CoA synthetase long-chain family member 3
• FACL3lignoceroyl-CoA synthase
• fatty-acid-Coenzyme A ligase, long-chain 3
• LACS 3
• LACS3
• Long-chain acyl-CoA synthetase 3
• long-chain-fatty-acid--CoA ligase 3
• PRO2194

Background

Long-chain-fatty-acid--CoA ligase 3, or ACSL3, is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. These proteins play an important role in both the biosynthesis of cellular lipids and degradation via beta-oxidation. Like other isozymes of this family, ALCS3 converts free long-chain fatty acids into fatty acyl-CoA esters. Specifically, ACSL3 mediates hepatic lipogenesis By similarity and has a mainly anabolic role in energy metabolism.

This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates. The amino acid sequence of this isozyme is 92% identical to that of rat homolog. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACSL3