SPINK6 Antibody

Images

 
Immunohistochemistry: SPINK6 Antibody [NBP2-13371] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPINK6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPINK6 Protein (NBP2-13371PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK6 Antibody

  • Kazal type 6
  • serine peptidase inhibitor, Kazal type 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1396
Species: Hu
Applications: WB
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-14260
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
MAB1569
Species: Hu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-14892
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1267
Species: Hu
Applications: WB, IP, Neut
NBP1-94203
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF2898
Species: Mu
Applications: WB, IP
NBP2-20648
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P

Publications for SPINK6 Antibody (NBP2-13371) (0)

There are no publications for SPINK6 Antibody (NBP2-13371).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPINK6 Antibody (NBP2-13371) (0)

There are no reviews for SPINK6 Antibody (NBP2-13371). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SPINK6 Antibody (NBP2-13371) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK6 Products

SPINK6 NBP2-13371

Bioinformatics Tool for SPINK6 Antibody (NBP2-13371)

Discover related pathways, diseases and genes to SPINK6 Antibody (NBP2-13371). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK6 Antibody (NBP2-13371)

Discover more about diseases related to SPINK6 Antibody (NBP2-13371).
 

Pathways for SPINK6 Antibody (NBP2-13371)

View related products by pathway.

Blogs on SPINK6

There are no specific blogs for SPINK6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK6