Acetoacetyl CoA synthetase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Immunofluorescent staining of human cell line MCF7 shows localization to vesicles.
Immunohistochemistry: Acetoacetyl CoA synthetase Antibody [NBP2-38861] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Acetoacetyl CoA synthetase Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RVVGYLPNSEHAVEAMLAAASIGAIWSSTSPDFGVNGVLDRFSQIQPKLIFSVEAVVYNGKEHNHMEKLQQVVKGLPDLKKVVVI
Specificity
Specificity of human Acetoacetyl CoA synthetase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AACS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
Acetoacetyl CoA synthetase Antibody
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Acetoacetyl CoA synthetase Antibody

  • acetoacetate-CoA ligase
  • acetoacetyl-CoA synthetase
  • ACSF1FLJ41251
  • Acyl-CoA synthetase family member 1
  • EC 6.2.1
  • EC 6.2.1.16
  • FLJ12389
  • homolog of C. elegans supressor of ras 5 (sur-5)
  • Protein sur-5 homolog
  • SUR-5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66888
Species: Hu, Mu, Rt
Applications: WB, ChIP, IP
NBP1-90276
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82462
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-19561
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-213
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-31559
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB600-233
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NBP2-38861
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Acetoacetyl CoA synthetase Antibody (NBP2-38861) (0)

There are no publications for Acetoacetyl CoA synthetase Antibody (NBP2-38861).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Acetoacetyl CoA synthetase Antibody (NBP2-38861) (0)

There are no reviews for Acetoacetyl CoA synthetase Antibody (NBP2-38861). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Acetoacetyl CoA synthetase Antibody (NBP2-38861) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Acetoacetyl CoA synthetase Products

Bioinformatics Tool for Acetoacetyl CoA synthetase Antibody (NBP2-38861)

Discover related pathways, diseases and genes to Acetoacetyl CoA synthetase Antibody (NBP2-38861). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Acetoacetyl CoA synthetase Antibody (NBP2-38861)

Discover more about diseases related to Acetoacetyl CoA synthetase Antibody (NBP2-38861).
 

Pathways for Acetoacetyl CoA synthetase Antibody (NBP2-38861)

View related products by pathway.

Blogs on Acetoacetyl CoA synthetase

There are no specific blogs for Acetoacetyl CoA synthetase, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Acetoacetyl CoA synthetase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AACS
Uniprot
COVID-19 update