HMGCS2 Antibody

Western Blot: HMGCS2 Antibody [NBP2-33908] - Analysis using Anti-HMGCS2 antibody NBP2-33908 (A) shows similar pattern to independent antibody NBP2-33907 (B).

Immunocytochemistry/Immunofluorescence: HMGCS2 Antibody [NBP2-33908] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Analysis in human liver and cerebral cortex tissues. Corresponding HMGCS2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining of human cerebral cortex, kidney, liver and skeletal muscle using Anti-HMGCS2 antibody NBP2-33908 (A) shows similar protein distribution across tissues to independent antibody NBP2-33907 (B).

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

HMGCS2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGCS2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HMGCS2 Protein (NBP2-33908PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HMGCS2 Antibody

• 3-hydroxy-3-methylglutaryl coenzyme A synthase
• 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
• 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
• EC 2.3.3.10
• HMG-CoA synthase
• hydroxymethylglutaryl-CoA synthase, mitochondrial
• mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase

Background

HMGCS2 is an enzyme that condenses acetyl CoA with acetoacetyl CoA to form HMG CoA, which is the substrate for HMG CoA reductase. Together with HMG CoA lyase, it is responsible for ketone body biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGCS2
• Uniprot:
  • P54868(Human)