ABL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: ABL2 Antibody [NBP2-68946] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: ABL2 Antibody [NBP2-68946] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons and neuropil.

Immunohistochemistry-Paraffin: ABL2 Antibody [NBP2-68946] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ABL2 Antibody [NBP2-68946] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ABL2 Antibody [NBP2-68946] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABL2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABL2 Antibody - BSA Free (NBP2-68946) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABL2
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: Recommended conditions for IHC,Retrieval method: HIER pH6
• Control Peptide:

  ABL2 Recombinant Protein Antigen (NBP2-68946PEP)

Reactivity Notes

Mouse 86%, Rat 88%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for ABL2 Antibody - BSA Free

• Abelson murine leukemia viral (v-abl) oncogene homolog 2
• Abelson murine leukemia viral oncogene homolog 2
• Abelson-related gene protein
• Abelson-relatedgene)
• ABL2
• ABLL
• arg tyrosine kinase
• ARG
• EC 2.7.10
• EC 2.7.10.2
• FLJ22224
• FLJ31718
• FLJ41441
• tyrosine-protein kinase ABL2
• Tyrosine-protein kinase ARG
• v-abl Abelson murine leukemia viral oncogene homolog 2

Background

The gene product is a cytoplasmic tyrosine kinase which is closely related to but distinct from ABL1. The similarity of the proteins includes the tyrosine kinase domains and extends amino-terminal to include the SH2 and SH3 domains. This gene is expressed in both normal and tumor cells. Alternatively spliced transcript variants encoding different protein isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABL2