ABCA7 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABCA7 Antibody [NBP2-14250] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane, the Golgi apparatus & cell junctions.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human lymph node shows moderate positivity in lymphoid cells.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human spleen shows strong cytoplasmic positivity in a subset of cells in red pulp.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: ABCA7 Antibody [NBP2-14250] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VNRTFEELTLLRDVREVWEMLGPRIFTFMNDSSNVAMLQRLLQMQDEGRR QPRPGGRDHMEALRSFLDPGSGGYSWQDAHADVGHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
ABCA7 Recombinant Protein Antigen (NBP2-14250PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCA7 Antibody

  • ABCA-SSN
  • ABCXATP-binding cassette sub-family A member 7
  • ATP-binding cassette, sub-family A (ABC1), member 7
  • Autoantigen SS-N
  • EC 2.2.1.1
  • EC 3.6.3
  • EC 3.6.3.41
  • FLJ40025
  • Macrophage ABC transporter

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3034
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB400-132
Species: Hu, Mu, Rt, ChHa, Ha, Mk, Rb
Applications: WB, ICC/IF, IHC, IHC-P, In vitro
NBP1-90626
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NBP1-89310
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NBP2-23488
Species: Hu
Applications: ICC/IF (-), WB, ELISA, Flow, IHC, IHC-P
NBP2-14250
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for ABCA7 Antibody (NBP2-14250) (0)

There are no publications for ABCA7 Antibody (NBP2-14250).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA7 Antibody (NBP2-14250) (0)

There are no reviews for ABCA7 Antibody (NBP2-14250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCA7 Antibody (NBP2-14250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCA7 Products

Bioinformatics Tool for ABCA7 Antibody (NBP2-14250)

Discover related pathways, diseases and genes to ABCA7 Antibody (NBP2-14250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA7 Antibody (NBP2-14250)

Discover more about diseases related to ABCA7 Antibody (NBP2-14250).
 

Pathways for ABCA7 Antibody (NBP2-14250)

View related products by pathway.

PTMs for ABCA7 Antibody (NBP2-14250)

Learn more about PTMs related to ABCA7 Antibody (NBP2-14250).
 

Research Areas for ABCA7 Antibody (NBP2-14250)

Find related products by research area.

Blogs on ABCA7

There are no specific blogs for ABCA7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA7
Entrez
Uniprot