BIN1 Antibody

Images

 
Orthogonal Strategies: Western Blot: BIN1 Antibody [NBP1-89102] - Analysis in human cell lines Caco-2 and MCF-7 using anti-BIN1 antibody. Corresponding BIN1 RNA-seq data are presented for the same cell lines. ...read more
Immunocytochemistry/ Immunofluorescence: BIN1 Antibody [NBP1-89102] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: BIN1 Antibody [NBP1-89102] - Staining in human skeletal muscle and heart muscle tissues using anti-BIN1 antibody. Corresponding BIN1 RNA-seq data are ...read more
Western Blot: BIN1 Antibody [NBP1-89102] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: BIN1 Antibody [NBP1-89102] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: BIN1 Antibody [NBP1-89102] - Staining of human heart muscle shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BIN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SSLPAVVVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Specificity
Specificity of human BIN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BIN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
BIN1 Lysate (NBP2-65149)
Control Peptide
BIN1 Protein (NBP1-89102PEP)
Publications
Read Publication using NBP1-89102.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BIN1 Antibody

  • AMPH2
  • Amphiphysin II
  • Amphiphysin-like protein
  • AMPHLDKFZp547F068
  • box dependant MYC interacting protein 1
  • bridging integrator 1Box-dependent myc-interacting protein 1
  • MGC10367
  • myc box-dependent-interacting protein 1
  • SH3P9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-66813
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87561
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-52667
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP, B/N, CyTOF-ready
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-86113
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB100-56094
Species: Hu
Applications: WB, IHC, IHC-P, IP
NLS2656
Species: Hu
Applications: WB, IHC, IHC-P, ICC
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF638
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-05645
Species: Hu
NBP1-90625
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-163
Species: Mu
Applications: WB, Flow, IHC-P
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P, IP, B/N, IF

Publications for BIN1 Antibody (NBP1-89102)(1)

Reviews for BIN1 Antibody (NBP1-89102) (0)

There are no reviews for BIN1 Antibody (NBP1-89102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BIN1 Antibody (NBP1-89102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BIN1 Antibody (NBP1-89102)

Discover related pathways, diseases and genes to BIN1 Antibody (NBP1-89102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BIN1 Antibody (NBP1-89102)

Discover more about diseases related to BIN1 Antibody (NBP1-89102).
 

Pathways for BIN1 Antibody (NBP1-89102)

View related products by pathway.

PTMs for BIN1 Antibody (NBP1-89102)

Learn more about PTMs related to BIN1 Antibody (NBP1-89102).

Blogs on BIN1

There are no specific blogs for BIN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BIN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BIN1