ABCA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ABCA3 Antibody [NBP1-89310] - Staining of human cell line HUVEC TERT2 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ABCA3 Antibody [NBP1-89310] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABCA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABCA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ABCA3 Protein (NBP1-89310PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABCA3 Antibody

  • ABC transporter 3
  • ABC3MGC72201
  • ABC-C transporter
  • ABC-C
  • ATP-binding cassette 3
  • ATP-binding cassette sub-family A member 3
  • ATP-binding cassette transporter 3
  • ATP-binding cassette, sub-family A (ABC1), member 3
  • EC 3.6.3
  • EC 3.6.3.17
  • EST111653
  • LBM180
  • MGC166979
  • SMDP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87201
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57977
Species: Hu
Applications: WB, IHC
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NB400-105
Species: Hu, Mu, Rt, Po, Ca, Ch, Ha, Md
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, GS
NBP1-30032
Species: Hu, Mu, Bv, Xp
Applications: WB, IHC, IHC-Fr
NBP2-14249
Species: Hu
Applications: IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93466
Species: Hu, Mu
Applications: ICC/IF, IP, PEP-ELISA
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP2-46466
Species: Hu
Applications: IHC
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
DDX0191P-100
Species: Hu, Mu, Ca, Fe, Sh
Applications: ICC/IF, IHC, IHC-P
NB400-166
Species: Mu
Applications: WB, Flow, IHC-P
NBP1-56876
Species: Hu
Applications: WB

Publications for ABCA3 Antibody (NBP1-89310) (0)

There are no publications for ABCA3 Antibody (NBP1-89310).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCA3 Antibody (NBP1-89310) (0)

There are no reviews for ABCA3 Antibody (NBP1-89310). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ABCA3 Antibody (NBP1-89310) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABCA3 Products

Bioinformatics Tool for ABCA3 Antibody (NBP1-89310)

Discover related pathways, diseases and genes to ABCA3 Antibody (NBP1-89310). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABCA3 Antibody (NBP1-89310)

Discover more about diseases related to ABCA3 Antibody (NBP1-89310).
 

Pathways for ABCA3 Antibody (NBP1-89310)

View related products by pathway.

PTMs for ABCA3 Antibody (NBP1-89310)

Learn more about PTMs related to ABCA3 Antibody (NBP1-89310).

Blogs on ABCA3

There are no specific blogs for ABCA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABCA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCA3