5T4 Antibody

Images

 
Western Blot: 5T4 Antibody [NBP1-90315] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: 5T4 Antibody [NBP1-90315] - Staining of human stomach shows strong membranous and cytoplasmic positivity in glandular cells

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

5T4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWVCDCHMADMVTWLKETEVVQGKDRLTCAYPEKMRNRVLLELNSADLDCDPILP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPBG
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
5T4 Protein (NBP1-90315PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 5T4 Antibody

  • 5T4 oncofetal trophoblast glycoprotein
  • 5T4 oncotrophoblast glycoprotein
  • 5T4
  • 5T4AG
  • 5T4-AG
  • 5T4M6P1,5T4 oncofetal antigen
  • M6P1
  • TPBG
  • trophoblast glycoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS046
Species: Hu, Mu, Rt, Bv, Ca, Ch, GP, Pm, Ze
Applications: WB
MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-03274
Species: Hu, Rt, Ze
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF5070
Species: Hu
Applications: WB, Simple Western
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85142
Species: Hu
Applications: IHC, IHC-P
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87565
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85645
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90315
Species: Hu
Applications: WB, IHC, IHC-P

Publications for 5T4 Antibody (NBP1-90315) (0)

There are no publications for 5T4 Antibody (NBP1-90315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for 5T4 Antibody (NBP1-90315) (0)

There are no reviews for 5T4 Antibody (NBP1-90315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for 5T4 Antibody (NBP1-90315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 5T4 Products

Bioinformatics Tool for 5T4 Antibody (NBP1-90315)

Discover related pathways, diseases and genes to 5T4 Antibody (NBP1-90315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 5T4 Antibody (NBP1-90315)

Discover more about diseases related to 5T4 Antibody (NBP1-90315).
 

Pathways for 5T4 Antibody (NBP1-90315)

View related products by pathway.

PTMs for 5T4 Antibody (NBP1-90315)

Learn more about PTMs related to 5T4 Antibody (NBP1-90315).

Blogs on 5T4

There are no specific blogs for 5T4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 5T4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPBG
Entrez
Uniprot