PDE3A Antibody

Images

 
Western Blot: PDE3A Antibody [NBP1-85645] - Analysis in human cell lines HeLa and HEK293 using Anti-PDE3A antibody. Corresponding PDE3A RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunocytochemistry/ Immunofluorescence: PDE3A Antibody [NBP1-85645] - Immunofluorescent staining of human cell line HeLa shows localization to cytosol.
Immunohistochemistry-Paraffin: PDE3A Antibody [NBP1-85645] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western Blot: PDE3A Antibody [NBP1-85645] - Analysis in human cell line HELA.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PDE3A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SPQILTPPVICSSCGRPYSQGNPADEPLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYAPETMMFLDKPILAPEPLVMDNLDSIMEQLNT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDE3A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PDE3A Protein (NBP1-85645PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (81%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PDE3A Antibody

  • CGI-PDE A
  • CGI-PDE
  • cGMP-inhibited 3'-5'-cyclic phosphodiesterase A
  • cyclic GMP inhibited phosphodiesterase A
  • Cyclic GMP-inhibited phosphodiesterase A
  • EC 3.1.4
  • EC 3.1.4.17
  • phosphodiesterase 3A, cGMP-inhibited

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-15343
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02559
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2462
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, PEP-ELISA
NBP2-01171
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-645
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-03598
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-46355
Species: Hu
Applications: WB, IHC
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83275
Species: Hu
Applications: IHC, IHC-P
NBP1-83160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-672
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for PDE3A Antibody (NBP1-85645) (0)

There are no publications for PDE3A Antibody (NBP1-85645).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDE3A Antibody (NBP1-85645) (0)

There are no reviews for PDE3A Antibody (NBP1-85645). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PDE3A Antibody (NBP1-85645) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PDE3A Products

Bioinformatics Tool for PDE3A Antibody (NBP1-85645)

Discover related pathways, diseases and genes to PDE3A Antibody (NBP1-85645). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PDE3A Antibody (NBP1-85645)

Discover more about diseases related to PDE3A Antibody (NBP1-85645).
 

Pathways for PDE3A Antibody (NBP1-85645)

View related products by pathway.

PTMs for PDE3A Antibody (NBP1-85645)

Learn more about PTMs related to PDE3A Antibody (NBP1-85645).
 

Research Areas for PDE3A Antibody (NBP1-85645)

Find related products by research area.

Blogs on PDE3A

There are no specific blogs for PDE3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PDE3A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PDE3A